PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9027s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 655aa    MW: 73893.2 Da    PI: 5.8546
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9027s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.2e-53241511128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          lp GfrF+Ptdeel+++yL+ k++g++le+ +vi+e+d++k+ePwdLp  + +k++++ew+fF++rd+ky++g+r+nrat+ gyWkatgk
  Araha.9027s0002.1.p  24 LPLGFRFRPTDEELINHYLRLKINGRDLEV-RVIPEIDVCKWEPWDLPglSVIKTDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGK 112
                          699***************************.99***************6448899999******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d++++s k+  +g+kktLvfy+grap+ge+t+W+mheyr+
  Araha.9027s0002.1.p 113 DRTIKS-KKLIIGMKKTLVFYRGRAPRGERTNWIMHEYRA 151
                          ******.8999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-6415174IPR003441NAC domain
PROSITE profilePS5100558.59424174IPR003441NAC domain
PfamPF023652.8E-2725150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MNQTKNKTLP EMTTEQALLS MEALPLGFRF RPTDEELINH YLRLKINGRD LEVRVIPEID  60
VCKWEPWDLP GLSVIKTDDQ EWFFFCPRDR KYPSGHRSNR ATDIGYWKAT GKDRTIKSKK  120
LIIGMKKTLV FYRGRAPRGE RTNWIMHEYR ATDKELDGTG PGQNPYVLCR LFHKPSDSCD  180
PANCEDIENV NSTPTTTRCS PDDTSSEMVQ ETATSGVHAV DRSDDTERCL SDKGTNDVKP  240
DVSVINKTSV NHAETSRAKD RVLGKSLVEE NHLLRDIPTL YGPILSEKSY YPGQSSIGFA  300
TSHIDSMYSS DFGNCDYGLH FQDGASEQDA SLTDVLDEVF HNHNESSSER KDFAIPNMMH  360
WPGNTRLLST EYPFLKDSVA FVDGGADLFS PQHFVPDILA SRWVSEHNLD SKEVVEIQSS  420
SGSSRTVTPL HNNVFGQYAS SSYATIDPFN YNVNQPEQSS FEQNHVDSNI SPSNISGLNA  480
RSRENQTNLD SVVDQGTAPR RIRLQIEPSL TPVINKKERD EDNYEEDEVQ SAMSKVVEEE  540
STNLSTQGTA QRRIRLQTRL RKPLITINNR ERDSNGREEE AGHNKEKGDV SSSSSSSSSW  600
QKQKKIMKKS LVQYSSMVIL VAVIVVLVGV WKESRDAKCS FLFHQLDSFK GMFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-461917812169NO APICAL MERISTEM PROTEIN
1ut4_B3e-461917812169NO APICAL MERISTEM PROTEIN
1ut7_A3e-461917812169NO APICAL MERISTEM PROTEIN
1ut7_B3e-461917812169NO APICAL MERISTEM PROTEIN
3swm_A3e-461917815172NAC domain-containing protein 19
3swm_B3e-461917815172NAC domain-containing protein 19
3swm_C3e-461917815172NAC domain-containing protein 19
3swm_D3e-461917815172NAC domain-containing protein 19
3swp_A3e-461917815172NAC domain-containing protein 19
3swp_B3e-461917815172NAC domain-containing protein 19
3swp_C3e-461917815172NAC domain-containing protein 19
3swp_D3e-461917815172NAC domain-containing protein 19
3ulx_A4e-462417715171Stress-induced transcription factor NAC1
4dul_A3e-461917812169NAC domain-containing protein 19
4dul_B3e-461917812169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.9027s0002.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0461890.0BT046189.1 Arabidopsis thaliana unknown protein (At1g33060) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893753.20.0NAC domain-containing protein 14
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLD7KIF50.0D7KIF5_ARALL; ANAC014
STRINGfgenesh1_pm.C_scaffold_10026390.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.10.0NAC 014