PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8902s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 485aa    MW: 52043.6 Da    PI: 8.4597
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8902s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR452.2e-143171142
                  TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                         ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  Araha.8902s0003.1.p 31 QKKKQCNCKHSRCLKLYCECFASGSYCDG-CNCLNCFNNVEN 71
                         589**************************.********9875 PP

2TCR51.91.5e-16116155140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          +++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Araha.8902s0003.1.p 116 RHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 155
                          589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.8E-163171IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.4232156IPR005172CRC domain
PfamPF036381.1E-103368IPR005172CRC domain
SMARTSM011141.0E-19116157IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.1E-13119154IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
TPIPPPPQSQ GILHVPIRHP PVGEARDGTP QKKKQCNCKH SRCLKLYCEC FASGSYCDGC  60
NCLNCFNNVE NEPARREAIG STLERNPNAF RPKIAASPHG GRDNREEVGE VVMLGRHNKG  120
CHCKKSGCLK KYCECFQANI LCSENCKCLD CKNFEGSEVR QSLFHGEHSN NVAYLQHANA  180
AITGAIGSSG FASAPAPKRR KGQEIFFNQG PKDSSTHRLG QANSGRTTSP KTGSHAGGNA  240
SLGPPKVVYR SLLADIIKPK DVKALCSVLV AVAGEAAKTL TEKRLADQKE TSVVSSVQDQ  300
GHGNNKGTEG EKAASGNQAE KSGRDGSKGR SLSPETLALM CDERDTMLMV AASPNCSVEP  360
ISQLPDGQDQ VYAEQEKVIL TRFRDCLNRI ISCGEVKESN CLMSRMDLDT PVHTAAKIDP  420
VVDQRPVANG VSQTAKQPSQ LTTTTKTTTT TTITTTTTTT TTTPNTSSQT HLHKTPALSE  480
KKDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-32231651132Protein lin-54 homolog
5fd3_B5e-32231651132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.8902s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020887986.10.0protein tesmin/TSO1-like CXC 6
RefseqXP_020887987.10.0protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLD7L5B70.0D7L5B7_ARALL; Predicted protein
STRINGAl_scaffold_0003_34880.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein