PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8824s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 306aa    MW: 35275.6 Da    PI: 7.8249
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8824s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81.1e-5381361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatg 87 
                          +ppGfrFhPtdeel+++yLkkk++ +k+e+ evikevd++k+ePwdL+   k+ +  ++ewyfFs++d+ky+tg+r+nrat+sg+Wkatg
  Araha.8824s0002.1.p   8 VPPGFRFHPTDEELLHYYLKKKISYEKFEM-EVIKEVDLNKIEPWDLQDrcKIGStPQNEWYFFSHKDRKYPTGSRTNRATHSGFWKATG 96 
                          69****************************.99**************952333332456******************************* PP

                  NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +dk + +   +++g++ktLvfykgrap+g+ktdW+mheyr+
  Araha.8824s0002.1.p  97 RDKCIRN-CYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRI 136
                          ******9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-597156IPR003441NAC domain
PROSITE profilePS5100557.8028156IPR003441NAC domain
PfamPF023653.9E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MSSSNGGVPP GFRFHPTDEE LLHYYLKKKI SYEKFEMEVI KEVDLNKIEP WDLQDRCKIG  60
STPQNEWYFF SHKDRKYPTG SRTNRATHSG FWKATGRDKC IRNCYKKIGM RKTLVFYKGR  120
APHGQKTDWI MHEYRIEDTD DDPSEDGWVV CRVFKKKNLF KAGNDVSSSI NNNRLEARSF  180
IRRESSYQGI SMFELNKPEE ISVHQYPQPP MFQPHHKPLS IGYDYSLALL PRESEYQQAC  240
EPSGVEVGTC KTVGEWGMVN CQMGNHEDSS RAMRFEDEGN NNSSTVQPPS NLLSLRGENG  300
FLGLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50815815170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with SMB and BRN2, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.8824s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0270350.0AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002891038.10.0protein BEARSKIN1
SwissprotQ9C8780.0BRN1_ARATH; Protein BEARSKIN1
TrEMBLD7KIH40.0D7KIH4_ARALL; ANAC015
STRINGfgenesh2_kg.1__3458__AT1G33280.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33280.10.0NAC domain containing protein 15
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]