PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8689s0023.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 335aa    MW: 37976.1 Da    PI: 6.5994
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8689s0023.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.3e-56211481129
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdee++++yLk+kv ++++++  ++ e+d++k+ePwdLpk++k +eke yfF++rd+ky+tg r+nrat+sgyWkatgkdk
  Araha.8689s0023.1.p  21 LPPGFRFHPTDEEIITCYLKEKVLNSRFTA-VAMGEADLNKCEPWDLPKRAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKATGKDK 109
                          79*************************999.67***************99999************************************* PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                          e+++ kg lvg+kktLvfy+grapkgekt+Wvmheyrle
  Araha.8689s0023.1.p 110 EIFKGKGCLVGMKKTLVFYRGRAPKGEKTNWVMHEYRLE 148
                          ****9********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-6318173IPR003441NAC domain
PROSITE profilePS5100558.23421172IPR003441NAC domain
PfamPF023653.3E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAVVVEEGVV LNHGGEELVD LPPGFRFHPT DEEIITCYLK EKVLNSRFTA VAMGEADLNK  60
CEPWDLPKRA KMGEKEFYFF CQRDRKYPTG MRTNRATESG YWKATGKDKE IFKGKGCLVG  120
MKKTLVFYRG RAPKGEKTNW VMHEYRLEGK YSYHNLPKSA RDEWVVCRVF HKNNPSTTTQ  180
PMTRIPIEDL TRMDSLENID HLLDFSSLPP LIDPSFMGQT EQPNFKPINP PAYNISSPIQ  240
PHHFNTYQSI FNHQGFGSAS GSTYNNNEMI KMEQSLVSVS QETCLSSDVN ANTTTTTEVS  300
SGPVMKQEMG MMGMVNGSKS YEDLCDLRGV LWDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-5181742170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.8689s0023.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2283690.0AK228369.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-80-C22.
GenBankBT0057130.0BT005713.1 Arabidopsis thaliana clone RAFL14-80-C22 (R20123) putative NAM (no apical meristem) protein (At5g18270) mRNA, complete cds.
GenBankBT0060700.0BT006070.1 Arabidopsis thaliana clone U20123 putative NAM (no apical meristem) protein (At5g18270) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002873881.10.0NAC domain-containing protein 92
SwissprotQ9FK440.0NAC87_ARATH; NAC domain-containing protein 87
TrEMBLD7LXT40.0D7LXT4_ARALL; ANAC087
STRINGfgenesh1_pm.C_scaffold_60014620.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.10.0Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]