PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8594s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 350aa    MW: 39610.9 Da    PI: 6.8567
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8594s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.85.1e-17953347
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                         i n++ r+++f kR+ng+lKK +ELS+LC+++++ +i+s+ + + 
  Araha.8594s0001.1.p  9 IANERSRKTSFMKRKNGVLKKLNELSTLCGVQACALIYSPYQSVP 53
                         89*************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR004043.4E-8121IPR002100Transcription factor, MADS-box
SMARTSM004325.0E-20158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.278147IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-21293IPR002100Transcription factor, MADS-box
CDDcd002668.96E-30283No hitNo description
PfamPF003196.6E-16951IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-82136IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-83657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MKKVKLSLIA NERSRKTSFM KRKNGVLKKL NELSTLCGVQ ACALIYSPYQ SVPESWPSTK  60
GAKEVASKFM EMPSTTRAKK MMSQETYLME RITKAKEQLK NLVVENRESQ VRRFMFDCLE  120
GKMSDYRYDA KDLQDLLCCM NKYLGQLNGR IEILKETGES SSVSPFPTTI GVVDILDAAS  180
PSVLAADMTP SFVADASLVT APSGFSDHIQ YQEMNMNQNH HEPIQHHVPT NFCDCFQNQN  240
INNVQYQTPY NLFDQIQQGS YNMNINQDYS NYNLNLNLNL NSNQQQSFMN PMVEQQMGYA  300
GGRASIPFMD GNHYNYHQLP VVDLASTSYM PSITTTTTGV YDPYINNNL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.8594s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8306620.0AB830662.1 Arabidopsis halleri subsp. halleri AGL36 gene for agamous-like MADS-box protein AGL36, partial cds, isolate: e030.
GenBankAB8306630.0AB830663.1 Arabidopsis halleri subsp. tatrica AGL36 gene for agamous-like MADS-box protein AGL36, partial cds, isolate: e031.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020879058.10.0agamous-like MADS-box protein AGL36
SwissprotQ7XJK61e-170AGL36_ARATH; Agamous-like MADS-box protein AGL36
TrEMBLS6B3X10.0S6B3X1_ARAHA; Agamous-like MADS-box protein AGL36 (Fragment)
TrEMBLS6C6610.0S6C661_ARAHH; Agamous-like MADS-box protein AGL36 (Fragment)
STRINGAT5G26650.11e-168(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.11e-167AGAMOUS-like 36
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]