PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8490s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 369aa    MW: 40660.7 Da    PI: 6.5675
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8490s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10150207562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Araha.8490s0007.1.p 150 KRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 207
                          9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-17146210IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622148211IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-10150205No hitNo description
PfamPF001701.4E-9150208IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-10150201No hitNo description
CDDcd147033.93E-22151200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MEDPSNPKSN QSNLSQCPPL ATAPTPAPFR GPYHRRAHSE VQFRLPEDLD LSEPFGGFDE  60
LGSEDDLFCS YMDIEKLGSG SGSASDSAGP SAPRSDNPFS ADNGGAEAGN SRPRHRHSLS  120
VDGSSTLESI EAKKAMAPDK LAELWVVDPK RAKRIIANRQ SAARSKERKA RYILELERKV  180
QTLQTEATTL SAQLSLFQRD TTGLSSENTE LKLRLQVMEQ QAKLRDALNE QLKKEVERLK  240
FATGEVSPAD AYNLGMAHMQ YQHQPQQSFF QHHQQQTDAQ NLQQMTHQFH LFQPNNNQNP  300
NSSSRSNPPT AHQLMHHATS NAPAQSHSYS EAIHEDPLGR LQGLDISSCG RGSNFGRSDT  360
VSESSSTM*
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.8490s0007.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881732.10.0transcription factor RF2b
SwissprotO228730.0BZP18_ARATH; bZIP transcription factor 18
TrEMBLD7LF630.0D7LF63_ARALL; BZIP transcription factor family protein
STRINGfgenesh2_kg.4__2179__AT2G40620.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]