PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8074s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 381aa    MW: 43287.5 Da    PI: 10.0879
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8074s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.13.8e-1453122373
                          EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT CS
                   B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkang 73 
                           +l+++++l+++ l lp ++++ +g++  + ++++l+d  grsWe+ l+++k+ g + +t+GW++F+++ng
  Araha.8074s0002.1.p  53 VALVKASNLEEDSLNLPQDCTSYNGLNR-KCRKIVLTDGGGRSWEMDLKFNKNLGCFSITRGWRHFCDENG 122
                          5688999***********9997778875.667*************************************97 PP

2B348.81.2e-15131220194
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f++v + +d lk++rl+l+++f++++g+ +  +k++tl  ++g +   +l +r +sgr+ l++GW eF++angLk g  ++++ ++ ++ 
  Araha.8074s0002.1.p 131 FVTVRVVPDCLKRCRLYLSRRFLKNNGLGE--TKMVTLLGTDGTRRLANL-VRETSGRMSLGRGWVEFANANGLKIGQYFTLESIWAND- 216
                          77888889***************9999885..569********9999999.799*****************************888533. PP

                          ..EE CS
                   B3  91 elvv 94 
                          ++ +
  Araha.8074s0002.1.p 217 SPIL 220
                          3455 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.3E-1543122IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-1346122IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.60151122IPR003340B3 DNA binding domain
SMARTSM010191.6E-452130IPR003340B3 DNA binding domain
CDDcd100175.13E-1352122No hitNo description
PfamPF023623.9E-1253122IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-15127228IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.73E-15128220IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.1E-20131226IPR003340B3 DNA binding domain
PfamPF023623.5E-14131222IPR003340B3 DNA binding domain
PROSITE profilePS5086310.8131226IPR003340B3 DNA binding domain
CDDcd100174.01E-13139215No hitNo description
Gene3DG3DSA:2.40.330.101.3E-9274369IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-11275369IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.9E-11278374IPR003340B3 DNA binding domain
PROSITE profilePS508639.206278374IPR003340B3 DNA binding domain
PfamPF023627.9E-8283370IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MFNVSACDIR DKPSPSNIDI KKLVLEREKK VRKINSQSEA IASTSSSDNS SFVALVKASN  60
LEEDSLNLPQ DCTSYNGLNR KCRKIVLTDG GGRSWEMDLK FNKNLGCFSI TRGWRHFCDE  120
NGKKLPTQKR FVTVRVVPDC LKRCRLYLSR RFLKNNGLGE TKMVTLLGTD GTRRLANLVR  180
ETSGRMSLGR GWVEFANANG LKIGQYFTLE SIWANDSPIL KLSSTNDSKS DKRKHRENFP  240
VASHKEFVST EASDGNELEK DMNTEEMINQ SSLIDNRFVI LALEPEDAKA GMLYLPSHFM  300
KANGIDKVGK IYMLGTNEME WWWGNLLTRD GIVSVGSRWR YFCKSNGVKI GQSFKLEYKY  360
KYDTRPVLKF VPSPRNKRNV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0072661e-85AC007266.5 Arabidopsis thaliana chromosome 2 clone F27A10 map mi238, complete sequence.
GenBankCP0026851e-85CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880608.10.0hypothetical protein ARALYDRAFT_901028
SwissprotF4IQL70.0REML2_ARATH; B3 domain-containing protein REM-like 2
TrEMBLD7LIB90.0D7LIB9_ARALL; Putative uncharacterized protein
STRINGscaffold_400529.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24696.10.0B3 family protein