PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8074s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 252aa    MW: 28289.5 Da    PI: 7.1256
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8074s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.74.3e-1320971596
                         -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3 15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                            lp +f++++g++k++  ++ +  ++g++ +v l  + ++ r+ l++GW++F+  ng + g++++++l++r+++ +++++
  Araha.8074s0001.1.p 20 FQGLPLPFMRANGLNKPG--EIGMLAKDGKKLTVSLLKDVNG-RMSLGRGWRDFALVNGFQIGESITLELIWRDST-PMFRF 97
                         3479***********777..7***************766665.578**************************6444.67765 PP

2B346.95.1e-15158248599
                          -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..E CS
                   B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelv 93 
                          l ++   k ++l+lp +f++++g++  +++t+t+  + + +W  +   + ++g++  + GW +F+kang+k+g  ++++++++  ++++v
  Araha.8074s0001.1.p 158 L-KPKDVKDCNLILPSEFMRAYGID--KHMTITILGKANMKWWGYP--SSRDGTIAVGIGWANFCKANGIKTGNLFTLEFISEeVDTSPV 242
                          4.445556778************99..688************9999..899999***************************8889***** PP

                          EEEE-S CS
                   B3  94 vkvfrk 99 
                          ++++ +
  Araha.8074s0001.1.p 243 FRICPN 248
                          ***976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010192.1E-125101IPR003340B3 DNA binding domain
PROSITE profilePS508639.536103IPR003340B3 DNA binding domain
CDDcd100174.58E-151297No hitNo description
Gene3DG3DSA:2.40.330.105.3E-1312100IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.0E-1413105IPR015300DNA-binding pseudobarrel domain
PfamPF023627.1E-122097IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-15148248IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-16151247IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.503153249IPR003340B3 DNA binding domain
SMARTSM010191.8E-15153249IPR003340B3 DNA binding domain
CDDcd100174.68E-10157247No hitNo description
PfamPF023629.3E-14157248IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
LLVSFINIMC YKYNLHLKNF QGLPLPFMRA NGLNKPGEIG MLAKDGKKLT VSLLKDVNGR  60
MSLGRGWRDF ALVNGFQIGE SITLELIWRD STPMFRFSST CTDSECDQRQ GEYCSQACEE  120
EPICIEPSGN RDKKEKNNIE DKEYSSLETL NRVLTLTLKP KDVKDCNLIL PSEFMRAYGI  180
DKHMTITILG KANMKWWGYP SSRDGTIAVG IGWANFCKAN GIKTGNLFTL EFISEEVDTS  240
PVFRICPNSG D*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880607.11e-163hypothetical protein ARALYDRAFT_901025
TrEMBLD7LIB61e-163D7LIB6_ARALL; Putative uncharacterized protein
STRINGscaffold_400526.11e-162(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142671121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.14e-62B3 family protein