PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.7747s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 464aa    MW: 51171.1 Da    PI: 5.449
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.7747s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.11.1e-25165221259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++vvei+++g H he
  Araha.7747s0008.1.p 165 RDGYNWRKYGQKQVKSPKGSRSYYRCTYTECCAKK-IECSNDSGNVVEIVNKGLHSHE 221
                          7********************************98.*********************8 PP

2WRKY98.54.3e-31328385259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  Araha.7747s0008.1.p 328 GDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVENTTAVIITYKGVHNHD 385
                          5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182905.75E-20160223IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.2E-20160223IPR003657WRKY domain
SMARTSM007743.5E-24164222IPR003657WRKY domain
PROSITE profilePS5081116.226166223IPR003657WRKY domain
PfamPF031069.0E-17166220IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-32312387IPR003657WRKY domain
PROSITE profilePS5081132.156322387IPR003657WRKY domain
SuperFamilySSF1182903.92E-27323387IPR003657WRKY domain
SMARTSM007743.6E-35327386IPR003657WRKY domain
PfamPF031068.4E-24329385IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MEETGIDEAK VYPVENSEKV ETEKDGLSQL RDEEESLGTD MEDLHDEAVP ETLGKDQVQG  60
VRENSSVEPN VEDVGEVNET DSVKEIVVSA IVPVDELEEN REVETYPFLA ASTDLLTVKP  120
SLSSSVPATA QDLSLVSVPT KQEQRSDSRV VNRLSVTPVP RTPARDGYNW RKYGQKQVKS  180
PKGSRSYYRC TYTECCAKKI ECSNDSGNVV EIVNKGLHSH EPPRKISFSP RETRVTTAIQ  240
PVSEDDTVVE ELTIVPSGSD PSVSTKENIC ESQTIVERKR HCENEAVEEP EPKRRLKKDN  300
SQSSDSVSKP GKKNKFVVHA AGDVGICGDG YRWRKYGQKM VKGNPHPRNY YRCTSAGCPV  360
RKHIETAVEN TTAVIITYKG VHNHDMPVPK KRHGPPSSML VAAAAPTSMR TRPDDQVNIP  420
TSSQCSVGRE SEKRSSEALD VGGEKVMESA RTLLSIGFEI KQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-25314387174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0051100.0BT005110.1 Arabidopsis thaliana clone U20909 putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
GenBankBT0040860.0BT004086.1 Arabidopsis thaliana clone RAFL15-37-C10 (R20909) putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567862.30.0WRKY DNA-binding protein 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLD7MBK50.0D7MBK5_ARALL; Putative uncharacterized protein
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32