PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.7369s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 237aa    MW: 27801.4 Da    PI: 9.8783
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.7369s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.46e-161150342
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         +en+  r v++ kRr+g+ K  +ELS+LCd++v++i+fs+
  Araha.7369s0005.1.p 11 VENDNSRAVSLKKRREGLVKMIKELSILCDIKVCMIMFSP 50
                         69************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.021149IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-21160IPR002100Transcription factor, MADS-box
CDDcd002661.91E-26285No hitNo description
SuperFamilySSF554559.03E-23295IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-151150IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRKKIKLAW VENDNSRAVS LKKRREGLVK MIKELSILCD IKVCMIMFSP YEVEPLVWPS  60
VEKARDVLDG FFALPEIEKK KKETSLESYL KEKTKKIHEK MMKTHKKNMN YAIAQLMVQL  120
HHGRKIHDLN LSEIYALISF SKDNIIRYRK ELDFVQYPSL RDPPVPPFEM PFEEFMTTTN  180
DVFVRKGQED ERVWKTDEVG KRISIGTAVK GNQTYYLLDK WVFPSSEPPN PRTHHQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKIKLAWVENDNSRAVSLKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.7369s0005.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020889440.11e-165MADS-box protein SVP-like
TrEMBLR0I8511e-107R0I851_9BRAS; Uncharacterized protein
TrEMBLV4NQI01e-107V4NQI0_EUTSA; Uncharacterized protein
STRINGBostr.19424s0082.1.p1e-133(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.18e-75AGAMOUS-like 48