PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.67312s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 443aa    MW: 48796.7 Da    PI: 7.431
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.67312s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.6e-102482851954
                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Araha.67312s0001.1.p 248 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 285
                           554459******************************88 PP

2BELL123.58.2e-40107178172
                  BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           erqe+q+kkakL ++l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  Araha.67312s0001.1.p 107 ERQEIQMKKAKLSNMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 178
                           79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.8E-8127176IPR006563POX domain
PfamPF075268.0E-4733175IPR006563POX domain
PROSITE profilePS5007112.26226289IPR001356Homeobox domain
SMARTSM003892.3E-9229293IPR001356Homeobox domain
CDDcd000861.14E-11229289No hitNo description
SuperFamilySSF466892.99E-17230296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-29232296IPR009057Homeodomain-like
PfamPF059201.6E-18246285IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
QPIHVGFGSG PGEDIRVGSG STGSGVTNGI ANLVSSKYLK AAQELLDEVV NADSDDMNAK  60
PQLFLSKKGS SGNDKAVGES SAGAGGEGSG GGGEAAGKRT VELGTAERQE IQMKKAKLSN  120
MLHEVEQRYR QYHQQMQMVI SSFEQAAGIG SAKSYTSLAL KTISRQFRCL KEAIAGQIKA  180
ANKSLGEEDS VSGVGRFEGS RLKFVDHHLR QQRALQQLGM IQHPSNNAWR PQRGLPERAV  240
SVLRAWLFEH FLHPYPKDSD KHMLAKQTGL TRSQVSNWFI NARVRLWKPM VEEMYMEEMK  300
EQGKNMGSME KTPLDQSNED SASKSTSNQE KSPMADTNYH MNPNHNGDLE GVTGMQGSPK  360
RLRTSDETMM QPINADFSSN EKLTMKILEE RQGIRSDGGY PFMGNFGQYQ MDEMSRFDVV  420
SDQELMAQRY SGNNNGVSLT LGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-17235292158Homeobox protein Meis1
4xrs_B3e-17235292158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.67312s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2272720.0AK227272.1 Arabidopsis thaliana mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL11-09-C20.
GenBankAY0721750.0AY072175.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0965480.0AY096548.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0998540.0AY099854.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankBT0084220.0BT008422.1 Arabidopsis thaliana At2g35940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881420.10.0BEL1-like homeodomain protein 1
RefseqXP_020883700.10.0BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLD7LIM10.0D7LIM1_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.4__1624__AT2G35940.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]