PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.6714s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 787aa    MW: 87630.4 Da    PI: 5.3007
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.6714s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.22e-42121198178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+Ceadls++k+yhrrhkvCe+hska++++v g+ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Araha.6714s0002.1.p 121 VCQVENCEADLSKVKDYHRRHKVCEMHSKATSAIVGGILQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNP 198
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.787119196IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.5E-33119183IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-39120200IPR004333Transcription factor, SBP-box
PfamPF031105.9E-31122195IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.203.4E-7689784IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484034.35E-7693785IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502978.667695787IPR020683Ankyrin repeat-containing domain
CDDcd002041.13E-8695785No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MEGEEAQHFY GFRAVDLRSV GKTSVEWDLN DWKWDGDLFL ATQLNPAASE TTGRQLFPLG  60
NSSNSSSSCS DEGNNTNMVE KKRRAVAIQG DSNAAGGLTL KLGDNACHLN AAKKTKFGAA  120
VCQVENCEAD LSKVKDYHRR HKVCEMHSKA TSAIVGGILQ RFCQQCSRFH LLQEFDEGKR  180
SCRRRLAGHN KRRRKTNPEP GANGNPSDDQ SSNYLLISLL KILSNMHNHT GDQDLMSHLL  240
KSLVSHAGEQ LGKNLVELLL QGGSQGSLNI GNSALLGIEQ APQEDLKQLS VNVPRQDGTA  300
TETRSEKQVK MNDFDLNDIY IDSDDTDIER SPPPTNPATS SLDYPSWIHQ SSPPQTSRNS  360
DSASDQSPSS SSEDAQMRTG RIVFKLFGKE PNEFPIVLRG QILDWLSHSP TDMESYIRPG  420
CIVLTIYLRQ AETAWEELLD DLGFSLRKLL DLSDDPLWTT GWIYVRVQNQ LAFVYNGQVV  480
VDTSLPLKSL DYSHIISVKP LAIAATGKAQ FTVKGINLRR RGTRLLCAVE GKYLIQETTH  540
DSTTGENDDL KENNEIVECV NFSCDMPITS GRGYMEIEDQ GLSSSFFPFL VVEDDDVCSE  600
IRILETTLEF TGTDSAKQAM DFIHEIGWLL HRSKLGESDP NPDVFPLIRF QWLIEFSMDR  660
EWCAVIRKLL NMFFDGAVGE FSSSSNATLS ELCLLHRAVR KNSKPMVEML LRYVPKKQRN  720
SLFRPDAAGP AGLTPLHIAA GKDGSEDVLD ALTEDPAMVG IEAWKTSRDS TGFTPEDYAR  780
LRGHFSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-32118195784squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.6714s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116290.0AJ011629.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 1.
GenBankAK2302690.0AK230269.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 1, complete cds, clone: RAFL23-28-L05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020883222.10.0squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLD7LFY40.0D7LFY4_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.4__2943__AT2G47070.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]