PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.65472s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 444aa    MW: 49945.6 Da    PI: 6.393
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.65472s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1254.1e-08128190163
                           XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++ +
  Araha.65472s0001.1.p 128 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLETIN 190
                           78899*******************************************999999999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001708.6E-8128190IPR004827Basic-leucine zipper domain
SMARTSM003382.7E-9128192IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979130193IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.17E-6132187No hitNo description
Gene3DG3DSA:1.20.5.1703.3E-7132198No hitNo description
CDDcd147022.14E-12138184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MTEMEAAEAL ADLAQLAIMR EQVFESAASW GSKGKRVRKR VKTESPPSDS LLKPPDSETL  60
PTPDLAEERL VKEEEEEEVQ PITKELTKAP VKTEVNGETP KPNLVSTLRC SSRSNGCGRS  120
RHNLSEAERE ERRIRRILAN RESARQTIRR RQAMCEELSK KAADLTYENE NLRREKDWAL  180
KEFQSLETIN KHLKEQVSKS VKPDTKEPEE STKPSQVDMS TSSTPFYFYN QNPYQLFYWP  240
HVTQSSNPTI SPLEFATSGG ASAKSMTSQE HENPADDNGQ KTHFYVVPCP WFLPPPDQSN  300
SVPFGLQNTQ RGTFSNGHHI DDSSARPIEV TETLRSHLPT RIKEEDSGSP ETRPLYDLNE  360
SATEVLSEGG DEFPITQQDY SLKHEDVSET TNGVTLMPPG HHVLISLPGK KQGSLAAAEA  420
RKRRKELTRL KNLHGRQCRM QVG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1420425RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.65472s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020870087.10.0uncharacterized protein LOC9326406
TrEMBLD7KI330.0D7KI33_ARALL; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_10016640.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein