PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.6475s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 279aa    MW: 31793.5 Da    PI: 9.2799
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.6475s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.18.9e-4681343128
                  NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                          pGfrFhPt+eel+++yLk+ v gk+ ++ evi  ++iy+++P+dLp   + +e+ewyfF++r++k+ +g r++r+t++gyWkatg+d+++
  Araha.6475s0002.1.p   8 PGFRFHPTEEELLDFYLKNMVYGKRSNV-EVIGFLNIYRHDPSDLPGLSRIGEREWYFFVPRERKHGNGGRPSRTTEKGYWKATGSDRKI 96 
                          9************************999.99***************7777899************************************* PP

                  NAM  93 lsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +s    ++++glkktLvfy+grap g+ktdWvm+e+r+
  Araha.6475s0002.1.p  97 ISLsePKRVIGLKKTLVFYRGRAPGGSKTDWVMNEFRM 134
                          987557778***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.4376152IPR003441NAC domain
SuperFamilySSF1019411.44E-547152IPR003441NAC domain
PfamPF023651.3E-248134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGKEIELPGF RFHPTEEELL DFYLKNMVYG KRSNVEVIGF LNIYRHDPSD LPGLSRIGER  60
EWYFFVPRER KHGNGGRPSR TTEKGYWKAT GSDRKIISLS EPKRVIGLKK TLVFYRGRAP  120
GGSKTDWVMN EFRMPDNCSL PKDVVLCKIY RKATSMKVLE QRAEMEAKMN QTCPNSPLSS  180
SETISFVGKE ENMMTSFRVP QVTAMEDANK ILTLQENAKT EEKQRETETK EPSSSLKLPF  240
GSLPELQLPK AGGEWGDQLL SISPWLQNLT PIVNLLNW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-43815217168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.6475s0002.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3618040.0AF361804.1 Arabidopsis thaliana At2g17040 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884035.10.0NAC domain-containing protein 35
SwissprotQ10S652e-84NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLD7L8Q90.0D7L8Q9_ARALL; ANAC036
STRINGfgenesh2_kg.3__3291__AT2G17040.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.10.0NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]