PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.6418s0010.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 431aa    MW: 48019.6 Da    PI: 8.6864
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.6418s0010.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-40178253277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          CqvegC+ dls+ak+yhr+h++Ce hsk p+v+vsg+e+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk++
  Araha.6418s0010.2.p 178 CQVEGCNLDLSSAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKKRSCRRRLSDHNARRRKPN 253
                          **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.2E-33173239IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.795175252IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-38176256IPR004333Transcription factor, SBP-box
PfamPF031103.3E-31178251IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MECNEKPSFQ WELENLISFG TSSAEIPRKL KPMEWEIDGF DCTSLYSSSF SAVAYGGSSG  60
SDLANAFSKS SKSTSISSSS AEVRTHNFTS EAGESLPGEL GSSEEFAKGI DTSPSLELSF  120
GSGDPVLGLK LGKRTYFEDF WEVENAKGLG LPVSLASSSV SPVKKSKSIP QRLQTPHCQV  180
EGCNLDLSSA KDYHRKHRIC ENHSKFPKVV VSGVERRFCQ QCSRFHCLSE FDEKKRSCRR  240
RLSDHNARRR KPNPGRTYDG KPQVDFVWNR FALIHPRSEE KFLWPSSKPV PSRGLMSQPA  300
KTETSNKLFT EHSRFGLLDP KTKTARTELF NKEKVTISSH MGTSQDLDGA LSLLSNSTSW  360
VSSDQPRRFT LDHHPTSNVQ PVANRSATQL NSVSRYWQPE PPTVEGPTAL HRNGVGQFNE  420
NCFSLNQFYN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-261782511184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1233250KKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.6418s0010.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157 (Probable). Up-regulated by Turnip mosaic virus P1/HC-Pro protein, that acts as an antagonist of miR156. {ECO:0000269|PubMed:12202040, ECO:0000269|PubMed:12586064, ECO:0000305}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116250.0AJ011625.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002863674.10.0squamosa promoter-binding-like protein 2
RefseqXP_020868863.10.0squamosa promoter-binding-like protein 2
RefseqXP_020868869.10.0squamosa promoter-binding-like protein 2
RefseqXP_020868875.10.0squamosa promoter-binding-like protein 2
RefseqXP_020868882.10.0squamosa promoter-binding-like protein 2
RefseqXP_020868888.10.0squamosa promoter-binding-like protein 2
RefseqXP_020868894.10.0squamosa promoter-binding-like protein 2
SwissprotQ9S8400.0SPL2_ARATH; Squamosa promoter-binding-like protein 2
TrEMBLD7MP970.0D7MP97_ARALL; Uncharacterized protein
STRINGscaffold_800740.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.30.0squamosa promoter binding protein-like 2