PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.63569s0001.1.p
Common NamePHE1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 284aa    MW: 32368.9 Da    PI: 4.9594
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.63569s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.77.4e-19953246
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                          +ien++ r++tf+kR++gi+KK +EL +LCd+e++ +i s+ + +
  Araha.63569s0001.1.p  9 FIENDTVRKTTFTKRKKGIMKKLHELVTLCDVEACAVINSPYNSI 53
                          8**************************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.264155IPR002100Transcription factor, MADS-box
CDDcd002663.42E-33184No hitNo description
SMARTSM004321.1E-24159IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-12222IPR002100Transcription factor, MADS-box
PfamPF003199.6E-17951IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-122237IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-123758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MRGKVKLSFI ENDTVRKTTF TKRKKGIMKK LHELVTLCDV EACAVINSPY NSIPEAWPSK  60
EGVEEVVSNF MEFSVIDRTK KMVDQETFIR QRIAKETEKL QKLRDENRNS QIRDLMFGCL  120
KGEIDVYHLD GRDLLDLSFF IDKYLNGLIR RVEILTENGE SSSSLPPPIG AAPIGVDAFA  180
PIGFDGHMIQ YQNQDQQKPV KFQYQALFDF YDQIPKKIHD FNMKMNIDSN QSMNLDLNQN  240
VNVGENEGIP CMDINNYQPE INCLTTITTT LTDVCAPNIT NDL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11530RKTTFTKRKKGIMKKL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269|PubMed:12815071}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.63569s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5033780.0EF503378.1 Arabidopsis halleri isolate PHE1Tenjin pheres1 (PHE1) gene, partial cds.
GenBankEF5033860.0EF503386.1 Arabidopsis lyrata isolate 08 clone b pheres1 (PHE1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020891468.10.0MADS-box transcription factor PHERES 1-like
SwissprotO808051e-172PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBLB2BFJ00.0B2BFJ0_ARAHA; Pheres1 (Fragment)
STRINGAT1G65330.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65330.11e-159M-type_MADS family protein
Publications ? help Back to Top
  1. Raissig MT,Bemer M,Baroux C,Grossniklaus U
    Genomic imprinting in the Arabidopsis embryo is partly regulated by PRC2.
    PLoS Genet., 2013. 9(12): p. e1003862
    [PMID:24339783]
  2. Jeong CW, et al.
    Control of Paternally Expressed Imprinted UPWARD CURLY LEAF1, a Gene Encoding an F-Box Protein That Regulates CURLY LEAF Polycomb Protein, in the Arabidopsis Endosperm.
    PLoS ONE, 2015. 10(2): p. e0117431
    [PMID:25689861]
  3. Burkart-Waco D,Ngo K,Lieberman M,Comai L
    Perturbation of parentally biased gene expression during interspecific hybridization.
    PLoS ONE, 2015. 10(2): p. e0117293
    [PMID:25719202]
  4. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]