PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.61839s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 335aa    MW: 38904.5 Da    PI: 6.7613
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.61839s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM50.19e-162013210128
                   NAM  10 tdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                           +de ++++yLk+ + + +   +++i++vd+++++P   +  +++  +++ f + + ++++   r+    +sg W+  g+dk ++sk +g
  Araha.61839s0001.1.p  20 EDEVIISRYLKRMIVNGDSWPDHFIEDVDVFNTNPD-VE--FYS--QSTRFVIVKTRTEHC-GRTDG-CESGCWRIIGRDKLIKSKeTG 101
                           588899*******98888666588***********6.43..223..233344444444444.45655.489*************99778 PP

                   NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                           +  g kk+L f k+++p+  k +Wvm+eyrl
  Araha.61839s0001.1.p 102 KILGFKKILKFCKKTKPREYKRSWVMEEYRL 132
                           889**************************98 PP

2NAM24.85.9e-0819631118128
                   NAM  18 yLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkk 104
                           yL+  ++ + ++      + d+y+++P +L   +  k +e  +  F++r k+     ++      gyW     ++ ++sk+ge  g  +
  Araha.61839s0001.1.p 196 YLQTIIDYDGNTW-PNYVTNDVYRLHPLTLVdpQDDKFKEFGTCIFANRTKACG---KTDECDGGGYWTIVEGHRGIKSKTGEILGYSR 280
                           5666555555555.3355679*********521333334447799999988775...56666789************************ PP

                   NAM 105 tLvfy.......kgrapkgektdWvmheyrl 128
                           ++ f          + ++ ++t W+++eyrl
  Araha.61839s0001.1.p 281 VFQFSeneepinVCEGEDVNETAWIIEEYRL 311
                           *****4443333123344459********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100526.70811150IPR003441NAC domain
PfamPF023652.3E-920132IPR003441NAC domain
SuperFamilySSF1019411.05E-2721149IPR003441NAC domain
PROSITE profilePS5100516.248178327IPR003441NAC domain
SuperFamilySSF1019417.72E-22194325IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MKAEDEGTYW LIKDELIKAE DEVIISRYLK RMIVNGDSWP DHFIEDVDVF NTNPDVEFYS  60
QSTRFVIVKT RTEHCGRTDG CESGCWRIIG RDKLIKSKET GKILGFKKIL KFCKKTKPRE  120
YKRSWVMEEY RLTNNLNPKQ DHVICKIRFL FEAEISFLLA KHFSYLSTRS PRPANDQLLP  180
AYGVCLFYTE AEGAFYLQTI IDYDGNTWPN YVTNDVYRLH PLTLVDPQDD KFKEFGTCIF  240
ANRTKACGKT DECDGGGYWT IVEGHRGIKS KTGEILGYSR VFQFSENEEP INVCEGEDVN  300
ETAWIIEEYR LDEKKKKDKV LCVIKKILIP LSPR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1309319RLDEKKKKDKV
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.61839s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6017510.0HE601751.1 Arabidopsis halleri subsp. halleri BAC clone 9G1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886627.20.0uncharacterized protein LOC9322693
RefseqXP_020889707.10.0uncharacterized protein LOC9322693
TrEMBLI0J3G80.0I0J3G8_ARAHH; NAC domain containing protein 23
STRINGscaffold_200589.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37041459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G60280.10.0NAC domain containing protein 23