PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.59992s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 247aa    MW: 28262.3 Da    PI: 4.6783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.59992s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.22.2e-5561331128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePwdL  k  + +++ ewyfF +rd+ky++g r+nrat+ gyWk+tg
  Araha.59992s0001.1.p   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWDLAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTG 93 
                           79****************************.99**************84335556888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd++v+s +++++g+kktLv+ykgrap+g +tdWvmheyrl
  Araha.59992s0001.1.p  94 KDRRVTS-QSRAIGMKKTLVYYKGRAPQGIRTDWVMHEYRL 133
                           *******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-654157IPR003441NAC domain
PROSITE profilePS5100560.8276156IPR003441NAC domain
PfamPF023652.1E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE VDLYKCEPWD LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRGGYWK STGKDRRVTS QSRAIGMKKT LVYYKGRAPQ  120
GIRTDWVMHE YRLDDKDCDD PSSLQDSYAL CRVFKKNGIC SELESERQLQ TGQCSFTTAS  180
MEEINSNNNN NYNNEYETMS PEVGVSSACV EEVVDDKDDS WMQFITDDAW DTSSNGAAMG  240
HGQGVY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-56215711169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.59992s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565950.0DQ056595.1 Arabidopsis thaliana no apical meristem family protein (At3g17730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002883083.10.0NAC domain-containing protein 86
SwissprotQ9FFI54e-91NAC86_ARATH; NAC domain-containing protein 86
TrEMBLD7L7C20.0D7L7C2_ARALL; Predicted protein
STRINGAl_scaffold_0003_18660.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85042839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-174NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]