PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.55234s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 213aa    MW: 24677.5 Da    PI: 4.9336
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.55234s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.64.2e-1857953128
                   NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +++kew+f s+r k  + g++k+r+ + gyW+at  +k++ + ++  vg k++L +y g++++g+k dW+mhey +
  Araha.55234s0001.1.p   5 GNDKEWFFISERIKIGEGGRHKKRVDNGGYWNATVATKKIDA-GNGIVGYKTSLDYYVGKQSNGVKGDWLMHEYWF 79 
                           5688***99999999999999999****************99.9999***************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100526.7261100IPR003441NAC domain
SuperFamilySSF1019417.45E-254100IPR003441NAC domain
PfamPF023651.1E-8877IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
KYEKGNDKEW FFISERIKIG EGGRHKKRVD NGGYWNATVA TKKIDAGNGI VGYKTSLDYY  60
VGKQSNGVKG DWLMHEYWFE SSDDNNNQKV DHALCKIYLT PTAAKKKKAE EGENEMKLKR  120
QEVVFKEEVK QLDLHQPDQL QPHDIVYQPQ PFPYDLDHFS ELISFEQQPM IPEDFEDFLA  180
DFIKPHSLDG DEESNNYGLF EGFFDTQGMI KH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-15710673174NAC domain-containing protein 19
3swm_B1e-15710673174NAC domain-containing protein 19
3swm_C1e-15710673174NAC domain-containing protein 19
3swm_D1e-15710673174NAC domain-containing protein 19
3swp_A1e-15710673174NAC domain-containing protein 19
3swp_B1e-15710673174NAC domain-containing protein 19
3swp_C1e-15710673174NAC domain-containing protein 19
3swp_D1e-15710673174NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.55234s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936541e-115AB493654.1 Arabidopsis thaliana At3g56530 mRNA for hypothetical protein, partial cds, clone: RAAt3g56530.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002878093.11e-125NAC transcription factor 29
TrEMBLD7LVH11e-124D7LVH1_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.5__2087__AT3G56530.11e-125(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56530.14e-96NAC domain containing protein 64