PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.5101s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 413aa    MW: 46882.6 Da    PI: 6.6058
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.5101s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.6e-51521772128
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                          +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ 
  Araha.5101s0001.1.p  52 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRM 140
                          79***************************.89***************888889************************************* PP

                  NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          + s++++ +glkktLvfy+g+apkg++t+W+m+eyrl
  Araha.5101s0001.1.p 141 IRSETSRPIGLKKTLVFYSGKAPKGTRTSWIMNEYRL 177
                          ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.27251198IPR003441NAC domain
SuperFamilySSF1019411.16E-5651198IPR003441NAC domain
PfamPF023653.0E-2553177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MAIVSSTTSI IPMSNQVNNN EKGIEDDDHR GGQESHVQND DEADDHDHDM VMPGFRFHPT  60
EEELIEFYLR RKVEGKRFNV ELITFLDLYR YDPWELPAMA AIGEKEWYFY VPRDRKYRNG  120
DRPNRVTTSG YWKATGADRM IRSETSRPIG LKKTLVFYSG KAPKGTRTSW IMNEYRLPHH  180
ETEKYQKAEI SLCRVYKRPG VEDHPSVPRS LSTRHHNHNS SSSSRLALRQ QQHHSSSSNH  240
SDNNLNNNNN INNLEKLSTE YSGDGSTTTT TTNSNSDVTI ALANQNIYRP MPYGTSNNTS  300
IISTSNQVDD ETAIVDDLQR LVNYQISDGG NINHQYFQIA QQFHHTQQQN ANANALQLVA  360
ATTATALTPQ TQAALAMNMI PTGTIPNNAL WDMWNPIVPD GNRDHYTNIP FK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-57421988165NO APICAL MERISTEM PROTEIN
1ut4_B6e-57421988165NO APICAL MERISTEM PROTEIN
1ut7_A6e-57421988165NO APICAL MERISTEM PROTEIN
1ut7_B6e-57421988165NO APICAL MERISTEM PROTEIN
4dul_A6e-57421988165NAC domain-containing protein 19
4dul_B6e-57421988165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.5101s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0008740.0BT000874.1 Arabidopsis thaliana clone C104984 putative NAM (no apical meristem) protein (At2g02450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020881085.10.0NAC domain-containing protein 35 isoform X1
SwissprotQ9ZVP80.0NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A178W0N40.0A0A178W0N4_ARATH; NAC035
STRINGAT2G02450.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.20.0NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]