PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.5008s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 1017aa    MW: 112180 Da    PI: 7.8825
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.5008s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.37.6e-22128176149
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                          +Cqv++C++dls+ak+yhrrhkvCevhska+++lv +++qrfCqqCsr 
  Araha.5008s0002.1.p 128 ICQVDNCTEDLSHAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRR 176
                          5**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-22121176IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.255126203IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-21127177IPR004333Transcription factor, SBP-box
PfamPF031101.3E-14129176IPR004333Transcription factor, SBP-box
PROSITE profilePS512969.212593649IPR017941Rieske [2Fe-2S] iron-sulphur domain
CDDcd002041.55E-7767910No hitNo description
SuperFamilySSF484037.93E-7767906IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.2E-5771904IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0016491Molecular Functionoxidoreductase activity
GO:0051537Molecular Function2 iron, 2 sulfur cluster binding
Sequence ? help Back to Top
Protein Sequence    Length: 1017 aa     Download sequence    Send to blast
MDEVGAQVAA PMFIHHPMGK KRDLYYPISN RLVPSQPRSD EWNSKMWDWD SRRFEAKPVD  60
VEVLRLGNEA QEFDLTLRNR SGEERGLDLN LGSGLTAVED LTPTTTTTQN VRPNKKVRSG  120
SPGGNYPICQ VDNCTEDLSH AKDYHRRHKV CEVHSKATKA LVGKQMQRFC QQCSRRKTTQ  180
PEEVASGVVV PGNRDNINNT STANMDLMAL LTALACAQGK NAVKPVGSPA VPDREQLLQI  240
LNKINALPLP MDLVSKLNNI GSLARKNMDN PTVNPQNDMN GASPSTMDLL AVLSTTLGSS  300
SPDALAILSQ GGFGNKDSEK TKLSSYEHGV TTNLEKRTFG FSSVGGERSS SSNQSPSQDS  360
DSRGQDTRSS LSLQLFTSSP EDESRPTVAS SRKYYSSASS NPVEDRSPSS SPVMQELFPL  420
QTSPETMRSK NHNNTSPRSG CLPLELFGAS NRGTANPNFK GFGQQSGYAS SGSDYSPPSL  480
NSDAQDRTGK IVFKLLDKDP SQLPGTLRSE IYNWLSNIPS EMESYIRPGC VVLSVYVAMS  540
PAAWEQLEQN LLQRLGVLQN SPSDFWRNAR FIVNTGRQLA SHKNGKVRCS KSWRTWNSPE  600
LISVSPVAVV AGEETSLVVR GRSLTNEGIS IRCTHMGSYM SMEVTGAVCR EAIFDKLNVD  660
SFKVQNVHPG FRGRCFIEVE NGFRGDSFPL IIANESICKE LNRLEEEFHP KSQDMTEEPA  720
QSSNRSPMSR EEVLCFLNEL GWLFQKNQTS QPREQSDFSL ARFKFLLVCS VERDYCALIR  780
TLLDMLVERN LVNDELNREA LEMLAEIQLL NRAVKRKSTK MVELLIHYSV NPSALSSSKK  840
FVFLPNITGP GGITPLHLAA CTSGSDAMID LLTNDPQEIG LSSWNTLCDA TGQTPYSYSA  900
MRNNHNYNSL VGRKLADKRN GQVSLNIEHE IVDQTGLSKR LSSEMNKSSS CASCATVALK  960
YQKRVSNSHR LFPTPIIHSM LAVATVCVCV CVFMHAFPIV RQGSHFSWGG LDYGSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A4e-22124175152squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.5008s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2269070.0AK226907.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 14, clone: RAFL09-16-H09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020868897.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLD7KJX20.0D7KJX2_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.1__2292__AT1G20980.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]