PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4956s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 293aa    MW: 33513.4 Da    PI: 5.2249
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4956s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-5261341128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          lppGfrFhPtdeel+ +yLk+kveg ++el evi+ +d+y+++Pw+Lp k  + +++ ew+fF++rdkky++g r+nr tk+gyWkatgk
  Araha.4956s0002.1.p   6 LPPGFRFHPTDEELIEYYLKRKVEGLEIEL-EVIPVIDLYSFDPWELPdKsFLPNRDMEWFFFCSRDKKYPNGFRTNRGTKAGYWKATGK 94 
                          79****************************.99**************96435556888******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d++++s++++ +g +ktLvfykgrap g +++W+mheyrl
  Araha.4956s0002.1.p  95 DRKITSRSSSIIGYRKTLVFYKGRAPLGDRSNWIMHEYRL 134
                          **************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-603158IPR003441NAC domain
PROSITE profilePS5100558.7026158IPR003441NAC domain
PfamPF023656.6E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGSSCLPPGF RFHPTDEELI EYYLKRKVEG LEIELEVIPV IDLYSFDPWE LPDKSFLPNR  60
DMEWFFFCSR DKKYPNGFRT NRGTKAGYWK ATGKDRKITS RSSSIIGYRK TLVFYKGRAP  120
LGDRSNWIMH EYRLCDDDSS QGSQNLKGAF VLCRVAMKKE IKSNSKIRKI PSEQTIGSGE  180
SSGFSSRVSS PSRDETMPFH SFANPVSTPT DSSNIWISPD FILDSSKDYP QIQDVASQYF  240
QQDFDFPIIG NQNMDFPAST SLDQNMDESM QTSYWTNYGY DQTGLFGYSD FS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-50615917166NO APICAL MERISTEM PROTEIN
1ut4_B1e-50615917166NO APICAL MERISTEM PROTEIN
1ut7_A1e-50615917166NO APICAL MERISTEM PROTEIN
1ut7_B1e-50615917166NO APICAL MERISTEM PROTEIN
4dul_A1e-50615917166NAC domain-containing protein 19
4dul_B1e-50615917166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in the positive regulation of abscisic acid (ABA) responsive genes. Acts as a positive factor of ABA-mediated responses. Involved in the transcriptional activation of ABA-inducible genes in response to dehydration and osmotic stresses. Plays a positive role in both stomatal closure and water loss under dehydration stress conditions. Acts synergistically with ABF2 to activate the dehydration stress-response factor RD29A transcription. Binds to the consensus core cis-acting elements 5'-CGTA-3' and 5'-CACG-3' at the RD29A promoter (PubMed:24285786). Involved in hypocotyl graft union formation. Required for the auxin-mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:25182467). {ECO:0000269|PubMed:24285786, ECO:0000269|PubMed:25182467}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00546DAPTransfer from AT5G46590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4956s0002.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and osmotic stress. {ECO:0000269|PubMed:24285786}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0203050.0BT020305.1 Arabidopsis thaliana At5g46590 gene, complete cds.
GenBankBT0205550.0BT020555.1 Arabidopsis thaliana At5g46590 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020870568.10.0NAC domain-containing protein 86
SwissprotQ9LS240.0NAC96_ARATH; NAC domain-containing protein 96
TrEMBLD7MRC40.0D7MRC4_ARALL; ANAC096
STRINGfgenesh2_kg.8__135__AT5G46590.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.10.0NAC domain containing protein 96
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]