PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4954s0011.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 352aa    MW: 39975.5 Da    PI: 5.4911
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4954s0011.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.42e-2125475128
                  NAM  75 nratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          nrat++gyWkatgkd+e+ + + +l g+kktLvf++grap+g +t+Wvmheyrl
  Araha.4954s0011.1.p   2 NRATNRGYWKATGKDREIRR-DIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 54 
                          8******************9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100530.921178IPR003441NAC domain
PfamPF023652.9E-10254IPR003441NAC domain
SuperFamilySSF1019411.83E-26279IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MNRATNRGYW KATGKDREIR RDIQLLGMKK TLVFHSGRAP DGLRTNWVMH EYRLVEYETE  60
KNGNLVQDAY VLCRVFHKNN IGPPSGNRYA PFMEEEWADD AGALIPGIDV KLRLEPPPVA  120
NGNNQMDQEI QSGSKSLINI NEPPRETAPM DIEPNQQNHH ENELKPQEHN NNNNYDENEE  180
TLKREHTEED ERPAPPVCVL NKEAPLPLLQ YKRRRQNESN NNSSRNTQDH CSSTTTTVDN  240
TTTLISSSAA ATNTAISALL EFSLMGISDK KEKPQQPLRP HKEPSPPQTP LASPEEKVND  300
LQKEIHQMSV ERETFKLEMM SAEAMISILQ SRIDALRQEN EELKKNNANG Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-2128090167NO APICAL MERISTEM PROTEIN
1ut4_B1e-2128090167NO APICAL MERISTEM PROTEIN
1ut7_A1e-2128090167NO APICAL MERISTEM PROTEIN
1ut7_B1e-2128090167NO APICAL MERISTEM PROTEIN
3swm_A1e-2128093170NAC domain-containing protein 19
3swm_B1e-2128093170NAC domain-containing protein 19
3swm_C1e-2128093170NAC domain-containing protein 19
3swm_D1e-2128093170NAC domain-containing protein 19
3swp_A1e-2128093170NAC domain-containing protein 19
3swp_B1e-2128093170NAC domain-containing protein 19
3swp_C1e-2128093170NAC domain-containing protein 19
3swp_D1e-2128093170NAC domain-containing protein 19
4dul_A1e-2128090167NAC domain-containing protein 19
4dul_B1e-2128090167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4954s0011.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597950.0AY059795.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
GenBankAY0912620.0AY091262.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882676.10.0NAC domain-containing protein 26 isoform X1
SwissprotQ9SQY00.0NAC52_ARATH; NAC domain containing protein 52
TrEMBLD7L8Z60.0D7L8Z6_ARALL; ANAC051/ANAC052
STRINGfgenesh2_kg.3__1083__AT3G10490.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.20.0NAC domain containing protein 52
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  4. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  5. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]