PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4954s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 391aa    MW: 44053 Da    PI: 6.071
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4954s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.83.9e-31149150128
                  NAM  50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          k+k++++ewyfFs  dkky +g r nrat++gyWkatgkd+e+ + + +l g+kktLvf++grap+g +t+Wvmheyrl
  Araha.4954s0010.1.p  14 KLKTRDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREIRR-DIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 91 
                          5678999*************************************9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.4751115IPR003441NAC domain
SuperFamilySSF1019412.35E-3711116IPR003441NAC domain
PfamPF023658.3E-151491IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MFACGSGNEV LFSKLKTRDQ EWYFFSALDK KYGNGARMNR ATNKGYWKAT GKDREIRRDI  60
QLLGMKKTLV FHSGRAPDGL RTNWVMHEYR LVEYETETNG SLLQDAYVLC RVFHKNNIGP  120
PSGNRYAPFM EEEWADGGGA LIPGIDVRVR VEALPQANGN NHMDQEIHSA SKDLININEL  180
PRDATPMDIE PNQKNHHESA FKLQENNNHS GYEEDEETLK REHAEEDERP PPLSILNKEA  240
PLPLLQYKRR RQNESNNNSS RSTQDHCSST ITTVDNTTTL TSSSSAAAAT NTAISALLEF  300
SLMGISDKKE NQQQPLSHHK EASPPSPVAS PEEKVNDLQK EIHQMSVERE TFKLEMMSAE  360
AMISILQSRI DALRQENEEL KKKNASGQAS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-32811764167NO APICAL MERISTEM PROTEIN
1ut4_B9e-32811764167NO APICAL MERISTEM PROTEIN
1ut7_A9e-32811764167NO APICAL MERISTEM PROTEIN
1ut7_B9e-32811764167NO APICAL MERISTEM PROTEIN
3swm_A1e-31811767170NAC domain-containing protein 19
3swm_B1e-31811767170NAC domain-containing protein 19
3swm_C1e-31811767170NAC domain-containing protein 19
3swm_D1e-31811767170NAC domain-containing protein 19
3swp_A1e-31811767170NAC domain-containing protein 19
3swp_B1e-31811767170NAC domain-containing protein 19
3swp_C1e-31811767170NAC domain-containing protein 19
3swp_D1e-31811767170NAC domain-containing protein 19
4dul_A9e-32811764167NAC domain-containing protein 19
4dul_B9e-32811764167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00342DAPTransfer from AT3G10480Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4954s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597950.0AY059795.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
GenBankAY0912620.0AY091262.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882675.10.0NAC domain-containing protein 78 isoform X1
SwissprotQ9SQX90.0NAC50_ARATH; NAC domain containing protein 50
TrEMBLD7L8Z50.0D7L8Z5_ARALL; ANAC050
STRINGfgenesh1_pm.C_scaffold_30008640.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.10.0NAC domain containing protein 50
Publications ? help Back to Top
  1. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]