PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.48421s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 281aa    MW: 32368.6 Da    PI: 8.9387
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.48421s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573124.45.3e-39100193297
                DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkife 90 
                           +fqr wse+DeivlLqG++dfk+++gksp+dd++af+++vk+ isf++++sq+ +KirrLK+K+ +k++k    +e+sf+k+hd k+f+
  Araha.48421s0001.1.p 100 YFQRKWSEDDEIVLLQGMVDFKNDKGKSPYDDMTAFIDTVKNIISFQANQSQFATKIRRLKDKYLRKRNK--GADENSFAKAHDLKCFQ 186
                           8********************************************************************9..88999************ PP

                DUF573  91 lskkiWg 97 
                           lsk iW+
  Araha.48421s0001.1.p 187 LSKVIWE 193
                           ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.8E-30101193IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MRGITKLLAS RSLKSSMAKK KKRSSTVKRC LQLLEDPPTK KRSQQPLENP PTTESSGDDE  60
EMATEEEGRE SGSSSEEEGK ESRSSSEEEE QKDPGTKKNY FQRKWSEDDE IVLLQGMVDF  120
KNDKGKSPYD DMTAFIDTVK NIISFQANQS QFATKIRRLK DKYLRKRNKG ADENSFAKAH  180
DLKCFQLSKV IWESTKVKEE SLKPNEEKVV DWFVNSSLVG SIASFGVAED VVKQRWSMVS  240
MKMKKELEEK FKLLKEKEYE YLWLKTRFFH EVNSLISEAN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12529TVKRC
2160166DKYLRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002894546.11e-157hypothetical protein ARALYDRAFT_892618
TrEMBLD7KN541e-157D7KN54_ARALL; Putative uncharacterized protein
STRINGscaffold_105412.11e-157(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01370.13e-75DNA-binding storekeeper protein-related transcriptional regulator