PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4814s0003.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 271aa    MW: 31337.5 Da    PI: 9.6463
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4814s0003.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.48.3e-51151371128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelvv+yL++kv+g +l++ +vi+e+d++k++PwdLp      e+e yfFs+r+ ky++g+r+nr+t sgyWkatg dk
  Araha.4814s0003.2.p  15 LPPGFRFHPTDEELVVQYLRRKVTGLPLPA-SVIPETDVCKSDPWDLPGD---CESERYFFSTREAKYPNGNRSNRSTGSGYWKATGIDK 100
                          79****************************.99***************44...46799******************************** PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++ + k+ +vg+kktLvfykg+ p+g++t+Wv+heyrl
  Araha.4814s0003.2.p 101 QIGK-KKLVVGMKKTLVFYKGKPPNGTRTNWVLHEYRL 137
                          **99.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6010158IPR003441NAC domain
PROSITE profilePS5100556.7415158IPR003441NAC domain
PfamPF023653.6E-2716137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEKRSSIKNR GVLRLPPGFR FHPTDEELVV QYLRRKVTGL PLPASVIPET DVCKSDPWDL  60
PGDCESERYF FSTREAKYPN GNRSNRSTGS GYWKATGIDK QIGKKKLVVG MKKTLVFYKG  120
KPPNGTRTNW VLHEYRLVDS QQESSYNMNW VLCRVFLKKR SNSNNKRKED EKEEIENEKD  180
KEKESEEENN KRTTCPIFYD FMRKDMKKKR RRRRRCCDLN LTPATCCCCS SSSSASSSSV  240
CSSALTHTSS NNNHHEEISC RENNKFCLFL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-541316118171NAC domain-containing protein 19
3swm_B5e-541316118171NAC domain-containing protein 19
3swm_C5e-541316118171NAC domain-containing protein 19
3swm_D5e-541316118171NAC domain-containing protein 19
3swp_A5e-541316118171NAC domain-containing protein 19
3swp_B5e-541316118171NAC domain-containing protein 19
3swp_C5e-541316118171NAC domain-containing protein 19
3swp_D5e-541316118171NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206211KKKRRR
2206214KKKRRRRRR
3208213KRRRRR
4208214KRRRRRR
5209214RRRRRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of the mannan synthase CSLA9. Recognizes and binds to DNA-specific sequence of CSLA9 promoter. {ECO:0000269|PubMed:24243147}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4814s0003.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3250800.0AF325080.1 Arabidopsis thaliana putative NAM (no apical meristem)-like protein (At2g33480) mRNA, complete cds.
GenBankAF4102990.0AF410299.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds.
GenBankAY0937300.0AY093730.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010469465.11e-146PREDICTED: NAC domain-containing protein 41-like
SwissprotO227981e-133NAC41_ARATH; NAC domain-containing protein 41
TrEMBLR0HQU61e-135R0HQU6_9BRAS; Uncharacterized protein
STRINGXP_010469465.11e-145(Camelina sativa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33480.21e-115NAC domain containing protein 41
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]