PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4685s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 215aa    MW: 24198.4 Da    PI: 4.9491
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4685s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF29.31.1e-09849344
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                         ien + r+ +f kR+  ++K   E  +LCd++++ +i+s+ +
  Araha.4685s0006.1.p  8 IENGTSRKKSFNKRKPELMKELTEPVTLCDVKACAVIYSPYN 49
                         9**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.054146IPR002100Transcription factor, MADS-box
CDDcd001201.01E-13257No hitNo description
SMARTSM004323.0E-5257IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-13293IPR002100Transcription factor, MADS-box
PfamPF003192.2E-10849IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MKKKLSLIEN GTSRKKSFNK RKPELMKELT EPVTLCDVKA CAVIYSPYNS NREALPSREC  60
VEEVVSEEFM EVSRNDRNKS MMDQEALLRE RIEKEQMELK KLRDENRDLR AREIMWGCLG  120
GNIDVHQLGE KDLQDLSSVI DNYLNSVTSR IEILKKNGES SSSLPPLVVP DLNVEEDGTI  180
LSMDGSHHQS ETTRLATITT TATDACAPNI TNNP*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4685s0006.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8306430.0AB830643.1 Arabidopsis halleri subsp. gemmifera PHE2 gene for pheres2, partial cds, isolate: e011.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176201.16e-71MADS-box family protein
RefseqXP_010513520.11e-70PREDICTED: MADS-box transcription factor PHERES 2-like
SwissprotQ7XJK83e-61PHE2_ARATH; MADS-box transcription factor PHERES 2
TrEMBLS6C6531e-151S6C653_ARAHG; Pheres2 (Fragment)
STRINGscaffold_201366.11e-108(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.13e-49AGAMOUS-like 38
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]