PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4375s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 242aa    MW: 27104.5 Da    PI: 8.1909
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4375s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM129.82e-4051361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                          lp+GfrF Pt+ el+++yL+ ++ g + ++++ i+ +d+++veP +Lp+    +++++ ++w fF++r++++a+g r++r+t sgyWkat
  Araha.4375s0001.1.p   5 LPVGFRFYPTEVELLTYYLRIQLGGGNATIHSLIPILDVFSVEPTQLPNlageRCRGDAEQWLFFVPRQEREARGGRPSRTTGSGYWKAT 94 
                          79****************************999**************9656766667888****************************** PP

                  NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          g+  +v+s +++++g+kkt+vfy+g+ap+g+kt+W m+ey++
  Araha.4375s0001.1.p  95 GSPGPVFSPDNRVIGVKKTMVFYTGKAPTGRKTKWKMNEYKA 136
                          ****************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-443160IPR003441NAC domain
PROSITE profilePS5100546.7835160IPR003441NAC domain
PfamPF023654.9E-206135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEEELPVGFR FYPTEVELLT YYLRIQLGGG NATIHSLIPI LDVFSVEPTQ LPNLAGERCR  60
GDAEQWLFFV PRQEREARGG RPSRTTGSGY WKATGSPGPV FSPDNRVIGV KKTMVFYTGK  120
APTGRKTKWK MNEYKAVETN SISTIPKLRN EFSICRIYIK SGSSRAFDRR PTEAYAIERT  180
LPSHGVETSS RATLSTSPET SHSGGNQIDL PENVTTITQS ISEMVDGLSQ PFWEWEQMNW  240
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-35516520173NAC domain-containing protein 19
3swm_B1e-35516520173NAC domain-containing protein 19
3swm_C1e-35516520173NAC domain-containing protein 19
3swm_D1e-35516520173NAC domain-containing protein 19
3swp_A1e-35516520173NAC domain-containing protein 19
3swp_B1e-35516520173NAC domain-containing protein 19
3swp_C1e-35516520173NAC domain-containing protein 19
3swp_D1e-35516520173NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4375s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1386411e-118AL138641.2 Arabidopsis thaliana DNA chromosome 3, BAC clone T22K7.
GenBankCP0026861e-118CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118771.11e-168NAC domain containing protein 61
SwissprotQ9M2901e-156NAC61_ARATH; Putative NAC domain-containing protein 61
TrEMBLB3H5061e-167B3H506_ARATH; NAC domain containing protein 61
STRINGAT3G44350.21e-168(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.21e-161NAC domain containing protein 61