PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4353s0017.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 359aa    MW: 39064.3 Da    PI: 7.9385
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4353s0017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322e-41100177178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +C v+gC++d+s+++eyh+rhkvC+vhsk+pvv+++g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Araha.4353s0017.1.p 100 ICLVDGCDSDFSNCREYHKRHKVCDVHSKTPVVTINGHKQRFCQQCSRFHALEEFDEGKRSCRKRLDGHNRRRRKPQP 177
                          5**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.5E-3393162IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.91598175IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-3999180IPR004333Transcription factor, SBP-box
PfamPF031103.7E-30101174IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MDWNFKVSSG YLSGFDQEPD LSPMDGSISF GGSSQSKGEF SFDLKLGRNN GNSSSVFGDT  60
EQVISLSKWK ESSLAKPESS RSSSSKRTRG NGAGTNQMPI CLVDGCDSDF SNCREYHKRH  120
KVCDVHSKTP VVTINGHKQR FCQQCSRFHA LEEFDEGKRS CRKRLDGHNR RRRKPQPEHI  180
GRPANFFTGF QGSKLLEFSG GSHVFPTTSV LNPSWGNSLV SVAVAANGSS YGQNQSYVGS  240
SPAKTGIMFP ISSSPNSNRR IGKQFPFLQE EESSRTASLC ERMTSCIHDS DCALSLLSSS  300
SSSVPHLLQP PLSLSQEAVE TVFYGSGLFE NASAVSDGSV ISGNEAVPLP QTFPFHWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2893174384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157174KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4353s0017.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1174750.0AK117475.1 Arabidopsis thaliana At5g50670 mRNA for unknown protein, complete cds, clone: RAFL17-08-M12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865818.10.0squamosa promoter-binding-like protein 13A
SwissprotB9DI200.0SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI110.0SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLD7MQ980.0D7MQ98_ARALL; Uncharacterized protein
STRINGscaffold_801495.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.10.0SBP family protein
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]