PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4300s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 246aa    MW: 26700.6 Da    PI: 8.5826
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4300s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822217.33.5e-6721451149
               DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasas 89 
                          ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++ e++e++g sa+as
  Araha.4300s0012.1.p   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCSRPvERMEIGGGSATAS 91 
                          5899**********************************************************************999************* PP

               DUF822  90 pesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                          p+ss+q        +sp++sy++sp ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
  Araha.4300s0012.1.p  92 PCSSYQ--------PSPCASYNPSPGSSNFMSPASSSFANLTSGdgQSLIPWLKHLSTTSSS 145
                          ******........**********************9999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.8E-643140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCSRPVER MEIGGGSATA SPCSSYQPSP CASYNPSPGS SNFMSPASSS  120
FANLTSGDGQ SLIPWLKHLS TTSSSSASSS SRLPNYLYIP GGSISAPVTP PLSSPTARTP  180
RMNADWQQLN NSFFVSSTPP SPTRQIIPDS ECNTNGLVKA WEGERIHEES GSDDLELTLG  240
NSSTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472705.11e-148PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-127BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLD7KVU21e-123D7KVU2_ARALL; Putative uncharacterized protein
STRINGAT1G78700.11e-125(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-105BES1/BZR1 homolog 4