PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4299s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 409aa    MW: 46488.7 Da    PI: 6.5437
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4299s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.54.7e-15951244
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                         +i n+s r  tf kR+ gi+KK + L +LCd++++ +++s+  
  Araha.4299s0003.1.p  9 FIANNSLRRATFRKRKGGIMKKLHDLTTLCDVKACAVVYSPYE 51
                         899*************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.811148IPR002100Transcription factor, MADS-box
CDDcd002662.42E-30183No hitNo description
SMARTSM004321.4E-15159IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-9222IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-23293IPR002100Transcription factor, MADS-box
PfamPF003199.4E-15954IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-92237IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-93758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MRSKLKLSFI ANNSLRRATF RKRKGGIMKK LHDLTTLCDV KACAVVYSPY ENPAVWPSTE  60
GVQEVVSKFL ERPVTEQSKL MMNHETFLQS RITKEEKKLE SLRRENRESQ IKQFMIDCVE  120
GKMSERQYDA RDLQDLSSHI DHYINKLKSR LQLLTKNGES SSSFPPPLHT SVADAAPLAV  180
MGACLPMTQN QCEPVQPYIP AGLSDHIQYQ NMNLMNQNQQ EPVHYQALVD FDNPIQHGIY  240
DMNLNQNMSL DPNQYPFQHE PFMNMLMEYP HQQVGGYVGD HAHIPFMDGN YNYHQLPTVG  300
LTTTCHMPPS TTTTITTTTA PIDMILDPNQ YPFQHDPFMN MLIEYPHQQV GYVGEHEHIP  360
FLVGNHYNYH QLPTVGLTAT GHMPSTTTTT TTTTSPTDVC APSINNYL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.4299s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8306730.0AB830673.1 Arabidopsis halleri subsp. gemmifera AGL86 gene for agamous-like MADS-box protein AGL86, partial cds, isolate: e041.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020870830.10.0agamous-like MADS-box protein AGL86
SwissprotQ9C6V31e-148AGL86_ARATH; Agamous-like MADS-box protein AGL86
TrEMBLS6BCE00.0S6BCE0_ARAHG; Agamous-like MADS-box protein AGL86 (Fragment)
STRINGAT1G31630.11e-146(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31630.11e-131AGAMOUS-like 86
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]