PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.41818s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 222aa    MW: 25140.6 Da    PI: 9.0454
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.41818s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM103.33.3e-32521821128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLp.kkvkaeekewyfFskrdkkyat..gkrknratksgyWka 85 
                           lppG++F Ptdeel+v+yL++ ++g+k  l++v i++v+iy+++P++L  k +ka+ekew f s+r++   +  gkr++r+ + gyW+ 
  Araha.41818s0002.1.p  52 LPPGYKFAPTDEELIVHYLNPFAQGNKDALHNVpIHHVNIYESNPQQLSeKYAKANEKEWLFVSPRKQIVCKggGKRQKRSDDGGYWHV 140
                           79*************************9999999**************9567788999*******99987753488****99******* PP

                   NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               ++++  +++lv  k++L +y+g++p+g+k d +m+e+ l
  Araha.41818s0002.1.p 141 CVACQKIYM-GNRLVYYKTSLEYYNGKQPNGTKGDYLMQEFCL 182
                           *********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-3943197IPR003441NAC domain
PROSITE profilePS5100536.46752197IPR003441NAC domain
PfamPF023651.6E-1453181IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAIPQGNKRK ARSSPGRKIQ LPEPPHNPDV ASSSSSSVAQ NLISPSIETF VLPPGYKFAP  60
TDEELIVHYL NPFAQGNKDA LHNVPIHHVN IYESNPQQLS EKYAKANEKE WLFVSPRKQI  120
VCKGGGKRQK RSDDGGYWHV CVACQKIYMG NRLVYYKTSL EYYNGKQPNG TKGDYLMQEF  180
CLENNNENQA LCKIYLTPKA AKIQKKSEEE EKEKLLKEEA AL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-195219517163NO APICAL MERISTEM PROTEIN
1ut4_B2e-195219517163NO APICAL MERISTEM PROTEIN
1ut7_A2e-195219517163NO APICAL MERISTEM PROTEIN
1ut7_B2e-195219517163NO APICAL MERISTEM PROTEIN
3swm_A2e-195219520166NAC domain-containing protein 19
3swm_B2e-195219520166NAC domain-containing protein 19
3swm_C2e-195219520166NAC domain-containing protein 19
3swm_D2e-195219520166NAC domain-containing protein 19
3swp_A2e-195219520166NAC domain-containing protein 19
3swp_B2e-195219520166NAC domain-containing protein 19
3swp_C2e-195219520166NAC domain-containing protein 19
3swp_D2e-195219520166NAC domain-containing protein 19
4dul_A2e-195219517163NAC domain-containing protein 19
4dul_B2e-195219517163NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.41818s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191212.13e-76NAC domain containing protein 64
TrEMBLA0A384KMI27e-75A0A384KMI2_ARATH; NAC064
TrEMBLQ9LXY77e-75Q9LXY7_ARATH; NAC domain containing protein 64
STRINGAT3G56530.11e-75(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27931563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56530.12e-78NAC domain containing protein 64