PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.40634s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 367aa    MW: 42379.3 Da    PI: 5.5827
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.40634s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.6e-51161441128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat +g+Wkat
  Araha.40634s0001.1.p  16 VPPGFRFHPTEEELLHYYLRKKVNSQKIDL-DVIREVDLNKLEPWDIQEecRIGStPQNDWYFFSHKDKKYPTGTRTNRATVAGFWKAT 103
                           69****************************.9***************963433332456****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           g+dk ++s   + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Araha.40634s0001.1.p 104 GRDKIICS-CIRRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                           ****9999.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5512178IPR003441NAC domain
PROSITE profilePS5100554.66916178IPR003441NAC domain
PfamPF023659.2E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MADNKVNLSI NGQSKVPPGF RFHPTEEELL HYYLRKKVNS QKIDLDVIRE VDLNKLEPWD  60
IQEECRIGST PQNDWYFFSH KDKKYPTGTR TNRATVAGFW KATGRDKIIC SCIRRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDTPLM SNGYSDVVIE DPMSYNEEGW VVCRVFRKKN  180
YQKIDDCPKI TLSSSPDDTE EEKRPTFHNI QNGTVLDHVL LYMDRTGSNI CMPESQTTTK  240
TQHQDDVLFM QLPSDLETPK SESPVDHSFM TSNQLDSSPV QEKILTGRPV CSNWASLDRL  300
VAWQLNNGHH NPCDRKSFDE EEENGDTMMQ RWDLHWNNDD NVDLWSSFTE SSSSPSSLDP  360
LLHLSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-471618015170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulate the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46. {ECO:0000269|PubMed:17114348, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:17890373}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.40634s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1018920.0EF101892.1 Arabidopsis thaliana SND1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893740.10.0NAC domain-containing protein 12
SwissprotQ9LPI70.0NAC12_ARATH; NAC domain-containing protein 12
TrEMBLD7KIC60.0D7KIC6_ARALL; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_10026190.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.10.0NAC domain containing protein 12
Publications ? help Back to Top
  1. Zhao Q, et al.
    Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.
    Phytochemistry, 2015. 112: p. 170-8
    [PMID:25107662]
  2. Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E
    Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana.
    J. Plant Physiol., 2015. 175: p. 86-94
    [PMID:25506770]
  3. Sakamoto S,Mitsuda N
    Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant.
    Plant Cell Physiol., 2015. 56(2): p. 299-310
    [PMID:25535195]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Huang J,Chen F,Wu S,Li J,Xu W
    Cotton GhMYB7 is predominantly expressed in developing fibers and regulates secondary cell wall biosynthesis in transgenic Arabidopsis.
    Sci China Life Sci, 2016. 59(2): p. 194-205
    [PMID:26803299]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]