PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.38479s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 212aa    MW: 24682.8 Da    PI: 6.924
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.38479s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B334.63.3e-112414586
                          EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                    B3 45 sWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                          sW+v +  + k +++++++GW +Fv +n Lk+g+f+ F +dg
  Araha.38479s0010.1.p  2 SWKVAM--KSKHEKVYFERGWANFVADNALKDGEFLSFVFDG 41
                          8*****..999999************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.872153IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-10251IPR015300DNA-binding pseudobarrel domain
CDDcd100175.89E-8250No hitNo description
SuperFamilySSF1019362.16E-10252IPR015300DNA-binding pseudobarrel domain
PfamPF023622.6E-8241IPR003340B3 DNA binding domain
SuperFamilySSF1019364.32E-6109199IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-4110199IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MSWKVAMKSK HEKVYFERGW ANFVADNALK DGEFLSFVFD GYRRYAVSIY GYGEKEINDD  60
ETKSDTDYSP DSLDTTTIFV ESVQVFNKSA TSRKRANTIE NPEAYLDDPN NISFETVVKN  120
RPYELLVHEQ FVKDYCLKFG DNIEYIDMFG KLTARTKKWG DQRVCINKWH DICRRNKFTK  180
NDSILCEIFR NGDNVVYAIK IHIIRDGVAR T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001189823.12e-88B3 domain-containing protein REM21
RefseqNP_187267.17e-89B3 domain-containing protein REM21
SwissprotQ9M8K28e-91REM21_ARATH; B3 domain-containing protein REM21
TrEMBLF4J9Q02e-88F4J9Q0_ARATH; B3 domain-containing protein REM21
STRINGAT3G06160.26e-88(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15612380
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06160.15e-92B3 family protein