PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3626s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family VOZ
Protein Properties Length: 484aa    MW: 53770.4 Da    PI: 6.035
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3626s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4441.8e-1362074231217
                  VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                          pppsaflgpkcalwdc+rpaqg++w+qdycssfha+la+neg+pg++pv+rp+gi+lkdgllfaalsak+ gk+vgipecegaatakspw
  Araha.3626s0008.1.p 207 PPPSAFLGPKCALWDCPRPAQGFDWFQDYCSSFHAALAFNEGPPGMNPVVRPGGIGLKDGLLFAALSAKAGGKDVGIPECEGAATAKSPW 296
                          89**************************************************************************************** PP

                  VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldal 180
                          na+elfdl++le+et+rewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m efgglkrsyymdpqp+++fewhlyeyein++da+
  Araha.3626s0008.1.p 297 NAPELFDLTVLESETLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQIMIEFGGLKRSYYMDPQPLHHFEWHLYEYEINKCDAC 386
                          ****************************************************************************************** PP

                  VOZ 181 alyrlelklvdekksakgkvskdsladlqkklgrlta 217
                          alyrlelklvd+kk++kgkvs+ds+adlqk++grlta
  Araha.3626s0008.1.p 387 ALYRLELKLVDGKKNSKGKVSNDSVADLQKQMGRLTA 423
                          ***********************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MTGKRSKTNC RSASHKLFKD KAKNRVDDLQ GMLLDLQFAR KESRTTDVTL LEEQVNQMLR  60
EWKSELNEPS PASSLQQGGT LGSFSSDICR LLQLCDEEDD ATSKLAAPKP EPADQNLEAG  120
KAAVFQRGYN LVQGKSEHGL PLVDHCKDLS LAAGNNFDGT APLEYHQQYD LQQEFEPNFN  180
GGFNNCPSYG VVEGPIHISN FIPTICPPPS AFLGPKCALW DCPRPAQGFD WFQDYCSSFH  240
AALAFNEGPP GMNPVVRPGG IGLKDGLLFA ALSAKAGGKD VGIPECEGAA TAKSPWNAPE  300
LFDLTVLESE TLREWLFFDK PRRAFESGNR KQRSLPDYNG RGWHESRKQI MIEFGGLKRS  360
YYMDPQPLHH FEWHLYEYEI NKCDACALYR LELKLVDGKK NSKGKVSNDS VADLQKQMGR  420
LTAEFPPENN TNNNNKRCIK GRPKVSTKVA TGNVQNTVEQ ANDCGVGEEF NYLVGNLSDY  480
YIP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0202610.0BT020261.1 Arabidopsis thaliana At1g28520 gene, complete cds.
GenBankAB1252560.0AB125256.1 Arabidopsis thaliana AtVOZ1 mRNA for transcription factor AtVOZ1, complete cds.
GenBankAK2270140.0AK227014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-45-I22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890781.10.0hypothetical protein ARALYDRAFT_473072
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLD7KCX70.0D7KCX7_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__3026__AT1G28520.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein