PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.35607s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 133aa    MW: 15736.1 Da    PI: 9.6472
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.35607s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.4e-5261301125
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lppGfrFhPtdeelv +yL +kv+g+ +el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rdkky++g+r+nrat++gyWkatg
  Araha.35607s0009.1.p   6 LPPGFRFHPTDEELVAYYLDRKVNGRAIEL-EIIPEVDLYKCEPWDLPeKsFLPGNDMEWYFYSTRDKKYPNGSRTNRATREGYWKATG 93 
                           79****************************.99**************95334455788******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmhe 125
                           kd+ v s k+ ++g+kktLv+y+grap+g +t+W+m+ 
  Araha.35607s0009.1.p  94 KDRIVES-KKMKMGMKKTLVYYRGRAPHGLRTNWLMNW 130
                           **99999.9999************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-543129IPR003441NAC domain
PROSITE profilePS5100551.4296132IPR003441NAC domain
PfamPF023656.0E-267129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKVNG RAIELEIIPE VDLYKCEPWD LPEKSFLPGN  60
DMEWYFYSTR DKKYPNGSRT NRATREGYWK ATGKDRIVES KKMKMGMKKT LVYYRGRAPH  120
GLRTNWLMNW FD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-48112912138NO APICAL MERISTEM PROTEIN
1ut4_B1e-48112912138NO APICAL MERISTEM PROTEIN
1ut7_A1e-48112912138NO APICAL MERISTEM PROTEIN
1ut7_B1e-48112912138NO APICAL MERISTEM PROTEIN
3ulx_A1e-48212911136Stress-induced transcription factor NAC1
4dul_A1e-48112912138NAC domain-containing protein 19
4dul_B1e-48112912138NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.35607s0009.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1762781e-178AK176278.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL23-20-J17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010480185.14e-90PREDICTED: NAC domain-containing protein 86-like
RefseqXP_010480187.14e-90PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9FFI51e-70NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A397YME51e-87A0A397YME5_BRACM; Uncharacterized protein
TrEMBLA0A3P6BE601e-87A0A3P6BE60_BRACM; Uncharacterized protein
TrEMBLM4CGK21e-87M4CGK2_BRARP; Uncharacterized protein
STRINGXP_010480185.11e-89(Camelina sativa)
STRINGXP_010480187.11e-89(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81232640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-85NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]