PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.34090s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 319aa    MW: 35545.7 Da    PI: 9.1105
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.34090s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.6e-51141391128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrF Ptdeel+veyL++k++g++++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+d
  Araha.34090s0001.1.p  14 LPPGFRFYPTDEELMVEYLCRKAAGHDFSL-QLIAEIDLYKFDPWVLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTD 101
                           79***************************9.89***************8777899********************************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           k + + +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Araha.34090s0001.1.p 102 KVIST-EGRRVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                           99999.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-6610162IPR003441NAC domain
PROSITE profilePS5100559.76514162IPR003441NAC domain
PfamPF023651.3E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGLQELDPLA QLSLPPGFRF YPTDEELMVE YLCRKAAGHD FSLQLIAEID LYKFDPWVLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVISTEGRR VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLI EPSRRNGSTK LDDWVLCRIY KKQSSAQKQA YNNLMTSGRE  180
YSNNGSSTSS SSHQYDDVLE SLHEIDNRSL GFAAGSSNSL PRSHRPVLTN QKTGFHGLAR  240
EPSFDWANLV GQNSVPELGL SQNVPSLRYG DGGTQQQAEG IPRFNNNNSD VLAHHGFSVD  300
PVNGFGYSGQ QSSGFGFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-12011687174NAC domain-containing protein 19
3swm_B1e-12011687174NAC domain-containing protein 19
3swm_C1e-12011687174NAC domain-containing protein 19
3swm_D1e-12011687174NAC domain-containing protein 19
3swp_A1e-12011687174NAC domain-containing protein 19
3swp_B1e-12011687174NAC domain-containing protein 19
3swp_C1e-12011687174NAC domain-containing protein 19
3swp_D1e-12011687174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.34090s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by high salinity. Slightly up-regulated by drought, abscisic acid (ABA) and jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:15319476}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0490700.0AB049070.1 Arabidopsis thaliana AtNAC3 mRNA, complete cds.
GenBankBT0256590.0BT025659.1 Arabidopsis thaliana At3g15500 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882947.10.0NAC domain-containing protein 55
SwissprotQ9LDY80.0NAC55_ARATH; NAC domain-containing protein 55
TrEMBLD7L4U30.0D7L4U3_ARALL; ATNAC3
STRINGfgenesh2_kg.3__1697__AT3G15500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.10.0NAC domain containing protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zheng XY, et al.
    Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation.
    Cell Host Microbe, 2012. 11(6): p. 587-96
    [PMID:22704619]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  5. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  6. Gimenez-Ibanez S, et al.
    JAZ2 controls stomata dynamics during bacterial invasion.
    New Phytol., 2017. 213(3): p. 1378-1392
    [PMID:28005270]
  7. Hickman R, et al.
    Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network.
    Plant Cell, 2017. 29(9): p. 2086-2105
    [PMID:28827376]
  8. Fu Y,Ma H,Chen S,Gu T,Gong J
    Control of proline accumulation under drought via a novel pathway comprising the histone methylase CAU1 and the transcription factor ANAC055.
    J. Exp. Bot., 2018. 69(3): p. 579-588
    [PMID:29253181]