PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.34065s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 340aa    MW: 38021.7 Da    PI: 6.3745
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.34065s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.72.6e-54201461128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdee++++yLk+kv + ++++  +i ++d++k ePwdLpk +k +eke yfF++rd+ky+tg r+nrat sgyWkatgkd
  Araha.34065s0002.1.p  20 LPPGFRFHPTDEEIITHYLKEKVFNIRFTA-AAIGQADLNKNEPWDLPKIAKMGEKEFYFFCQRDRKYPTGMRTNRATVSGYWKATGKD 107
                           79*************************999.78***************8888899********************************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ke+++ kg lvg+kktLvfy+grapkgekt+Wvmheyrl
  Araha.34065s0002.1.p 108 KEIFRGKGCLVGMKKTLVFYRGRAPKGEKTNWVMHEYRL 146
                           *****9*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6216171IPR003441NAC domain
PROSITE profilePS5100558.23420171IPR003441NAC domain
PfamPF023651.0E-2821146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MVEEGGVVVN QAGDQEVVDL PPGFRFHPTD EEIITHYLKE KVFNIRFTAA AIGQADLNKN  60
EPWDLPKIAK MGEKEFYFFC QRDRKYPTGM RTNRATVSGY WKATGKDKEI FRGKGCLVGM  120
KKTLVFYRGR APKGEKTNWV MHEYRLDGKY SYHNLPKTAR DEWVVCRVFH KSDPSTTITP  180
TSQLSRIDSL DNIDHLLDFS SLPPLIDPGF LGQSSPSFSG VRQQHDLKPV LHHPTTAPVD  240
NTYLSTQTFN FPYHSVHNSG SDFGYGAGSG NNDKGMIKLE HSLVSVSQET GLSSDVNTTA  300
TPEISSYPMM MNPAAVMDGS KSACDDLDDL IFWEDLYTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-501817115165NO APICAL MERISTEM PROTEIN
1ut4_B2e-501817115165NO APICAL MERISTEM PROTEIN
1ut7_A2e-501817115165NO APICAL MERISTEM PROTEIN
1ut7_B2e-501817115165NO APICAL MERISTEM PROTEIN
3swm_A2e-501817218169NAC domain-containing protein 19
3swm_B2e-501817218169NAC domain-containing protein 19
3swm_C2e-501817218169NAC domain-containing protein 19
3swm_D2e-501817218169NAC domain-containing protein 19
3swp_A2e-501817218169NAC domain-containing protein 19
3swp_B2e-501817218169NAC domain-containing protein 19
3swp_C2e-501817218169NAC domain-containing protein 19
3swp_D2e-501817218169NAC domain-containing protein 19
4dul_A2e-501817115165NAC domain-containing protein 19
4dul_B2e-501817115165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that acts as positive regulator of leaf senescence. Activates NYC1, SGR1, SGR2 and PAO, which are genes involved in chlorophyll catabolic processes. Activates senescence-associated genes, such as RNS1, SAG12 and SAG13. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.34065s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0848520.0AY084852.1 Arabidopsis thaliana clone 119460 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884425.10.0NAC domain-containing protein 92
SwissprotQ9SQQ60.0NAC46_ARATH; NAC domain-containing protein 46
TrEMBLD7L2120.0D7L212_ARALL; ANAC046
STRINGfgenesh2_kg.3__366__AT3G04060.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04060.10.0NAC domain containing protein 46
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Oda-Yamamizo C, et al.
    Corrigendum: The NAC transcription factor ANAC046 is a positive regulator of chlorophyll degradation and senescence in Arabidopsis leaves.
    Sci Rep, 2016. 6: p. 35125
    [PMID:27759025]
  4. O'Shea C, et al.
    Structures and Short Linear Motif of Disordered Transcription Factor Regions Provide Clues to the Interactome of the Cellular Hub Protein Radical-induced Cell Death1.
    J. Biol. Chem., 2017. 292(2): p. 512-527
    [PMID:27881680]