PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3134s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 271aa    MW: 31474.6 Da    PI: 6.8605
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3134s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.9e-5491341128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeel+v+yL++++ +k++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra+ sgyWkatg+dk
  Araha.3134s0014.1.p   9 LPPGFRFHPTDEELIVYYLRNQTMSKPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDK 97 
                          79****************************.89***************99999************************************* PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++s ++++vg+kk Lvfykgr pkg ktdW+mheyrl
  Araha.3134s0014.1.p  98 AIHS-GSSNVGVKKALVFYKGRPPKGIKTDWIMHEYRL 134
                          ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-656161IPR003441NAC domain
PROSITE profilePS5100560.6119161IPR003441NAC domain
PfamPF023651.0E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEVNSSSTLP PGFRFHPTDE ELIVYYLRNQ TMSKPCPVSI IPEVDIYKFD PWQLPEKTEF  60
GENEWYFFSP RERKYPNGVR PNRAAVSGYW KATGTDKAIH SGSSNVGVKK ALVFYKGRPP  120
KGIKTDWIMH EYRLHDSRKA STKRNGSMRL DEWVLCRIYK KRGAGKLLNE QEGFIDEVLI  180
DEATVVVNEA ERRNEEEIMM NMTSTKLPRT CSLAHLLEMD YMGPVSHIFT DNFTQFDHIH  240
QPDSESGWFG DLQFNQDEIL NHHRQAMFKF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-70816616170NO APICAL MERISTEM PROTEIN
1ut4_B2e-70816616170NO APICAL MERISTEM PROTEIN
1ut7_A2e-70816616170NO APICAL MERISTEM PROTEIN
1ut7_B2e-70816616170NO APICAL MERISTEM PROTEIN
3swm_A2e-70816619173NAC domain-containing protein 19
3swm_B2e-70816619173NAC domain-containing protein 19
3swm_C2e-70816619173NAC domain-containing protein 19
3swm_D2e-70816619173NAC domain-containing protein 19
3swp_A2e-70816619173NAC domain-containing protein 19
3swp_B2e-70816619173NAC domain-containing protein 19
3swp_C2e-70816619173NAC domain-containing protein 19
3swp_D2e-70816619173NAC domain-containing protein 19
4dul_A2e-70816616170NAC domain-containing protein 19
4dul_B2e-70816616170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.3134s0014.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3602010.0AF360201.1 Arabidopsis thaliana unknown protein (At1g69490) mRNA, complete cds.
GenBankAY0510150.0AY051015.1 Arabidopsis thaliana unknown protein (At1g69490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002887238.10.0NAC transcription factor 29
SwissprotO492550.0NAC29_ARATH; NAC transcription factor 29
TrEMBLD7KX200.0D7KX20_ARALL; NAC domain protein NAC2
STRINGfgenesh2_kg.2__1206__AT1G69490.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77072641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.10.0NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Zhang K,Gan SS
    An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves.
    Plant Physiol., 2012. 158(2): p. 961-9
    [PMID:22184656]
  2. Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS
    Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12
    [PMID:23959884]
  3. Shinozaki Y, et al.
    Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span.
    J. Plant Physiol., 2014. 171(8): p. 633-8
    [PMID:24709156]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  6. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]