PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.31158s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 250aa    MW: 28321.8 Da    PI: 7.764
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.31158s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP90.82.9e-2842111271
                   TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                            g+kdrhsk++T +g+RdRR+Rls+ +a++++dLq++LG+ ++sk i+WLl+ ak  ++ l+ +++++  
  Araha.31158s0001.1.p  42 FGGKDRHSKVCTVRGLRDRRIRLSVMTAIQLYDLQERLGLSQPSKVIDWLLEVAKNDVDLLPPLQFPPGF 111
                           689************************************************************9666652 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.22544102IPR017887Transcription factor TCP subgroup
PfamPF036341.7E-2644143IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEEMRLREDM GIKQEDHHQK SSLSLLRQRW NNPRIVRVSR AFGGKDRHSK VCTVRGLRDR  60
RIRLSVMTAI QLYDLQERLG LSQPSKVIDW LLEVAKNDVD LLPPLQFPPG FRQLNPNLTG  120
LGESFPGVFD LGRTQRETLD LEKSKWVNLD HGFDHSDDLH FSNSIQSNKL SFPSSSSSYH  180
YNLGHLQQSL LDQSGNVTVA FSNNYNNNNL NPPAAETMSS LFPTRYPSFL GGGQLQLFCS  240
TSSQPDHIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-1749103155Putative transcription factor PCF6
5zkt_B4e-1749103155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00497DAPTransfer from AT5G08070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.31158s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3576120.0AL357612.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T22D6 (ESSA project).
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871306.21e-157transcription factor TCP17
SwissprotQ9LEZ91e-151TCP17_ARATH; Transcription factor TCP17
TrEMBLA0A178UHH91e-152A0A178UHH9_ARATH; TCP17
STRINGfgenesh2_kg.6__773__AT5G08070.11e-151(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08070.11e-144TCP domain protein 17
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]