PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3105s0045.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 207aa    MW: 23334.7 Da    PI: 9.3338
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3105s0045.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM110.32.3e-34151401128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lp G+rFhPt++el+ +yL +kv +++l+  ++i+ vd++ ++P ++p   +++ek+ yfF+k+++ +++++r + +  +gyWk  gk++
  Araha.3105s0045.1.p  15 LPIGYRFHPTEQELILHYLLPKVFASPLPS-SIIPVVDLFFSHPLTFPG--DQKEKQRYFFCKKREVSSNEHRIKISSGDGYWKPIGKER 101
                          699*************************99.89***************4..4578899******************************** PP

                  NAM  91 evlskkgelvglkktLvfy..kgrapkgektdWvmheyrl 128
                          ++++  g++ g+++tL+fy  ++++++ +kt+W m ey l
  Araha.3105s0045.1.p 102 PIIA-CGKTFGIRRTLAFYetNKSSSNCNKTKWSMTEYCL 140
                          ****.999***********4434667778*********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-4010159IPR003441NAC domain
PROSITE profilePS5100537.60115160IPR003441NAC domain
PfamPF023655.6E-2016140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MEVEKRIVVS GGMKLPIGYR FHPTEQELIL HYLLPKVFAS PLPSSIIPVV DLFFSHPLTF  60
PGDQKEKQRY FFCKKREVSS NEHRIKISSG DGYWKPIGKE RPIIACGKTF GIRRTLAFYE  120
TNKSSSNCNK TKWSMTEYCL AGFASAKVFG EWAVYNVYER KGSKGRKQSK SREGDAEELT  180
CVHHFMVGSD HETGPPPPSP PTSPDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-211314013140Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.3105s0045.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0842160.0AY084216.1 Arabidopsis thaliana clone 100085 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871595.11e-138NAC domain-containing protein 41
TrEMBLD7M5Z01e-137D7M5Z0_ARALL; ANAC084
STRINGfgenesh1_pm.C_scaffold_60010911e-138(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78742541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14000.11e-124NAC domain containing protein 84