PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.29023s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 340aa    MW: 37960.2 Da    PI: 8.8569
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.29023s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.91.1e-2424118299
                           EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                    B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                           f++++++++ ++++++lp++fa+++g++k  + +++l++e+g+sW+ k++ ++ s+++++ +GW++ + +n+L++gD+++Fkl + + +
  Araha.29023s0001.1.p  24 FSQTVTHSSISRDLVTLPRDFAKRNGLDKGMH-EIVLMNEEGKSWKSKVK-SNMSRQVYIVGGWRNLCTENKLEVGDSCTFKLLQ-NAK 109
                           6788999*******************998765.****************5.56666789999********************998.677 PP

                           ..EEEEE-S CS
                    B3  91 elvvkvfrk 99 
                           ++v++++++
  Araha.29023s0001.1.p 110 TPVFQLCSR 118
                           79****997 PP

2B343.84.5e-14124220199
                           EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-.TTHHHHHHHHT--TT-EEEEEE-SSS CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvlt.kGWkeFvkangLkegDfvvFkldgrs 88 
                           f+k + + ++l+ g   lp +f++ +g+++++  ++tl d++  +W++kl+++ ++g+y+++ + Wk+F+ an++  ++++++kl++  
  Araha.29023s0001.1.p 124 FVKLTPTLNSLEIGKQHLPVSFTKVNGLINPG--KMTLVDKDRVEWSMKLQVDTRGGMYIFGgTDWKSFCAANEVGKRESLTLKLIR-G 209
                           66777778888889999**********99666..79999*************9999998887589********************98.8 PP

                           EE..EEEEE-S CS
                    B3  89 efelvvkvfrk 99 
                           + ++++k+++k
  Araha.29023s0001.1.p 210 GLSPLLKFCSK 220
                           99999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.5E-2416117IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-2317117IPR015300DNA-binding pseudobarrel domain
CDDcd100172.80E-2123117No hitNo description
PROSITE profilePS5086315.10123119IPR003340B3 DNA binding domain
PfamPF023629.2E-2424118IPR003340B3 DNA binding domain
SMARTSM010191.7E-3124119IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-12122220IPR015300DNA-binding pseudobarrel domain
CDDcd100173.04E-14124219No hitNo description
PfamPF023621.4E-13124220IPR003340B3 DNA binding domain
SMARTSM010192.2E-19124221IPR003340B3 DNA binding domain
PROSITE profilePS5086311.307124221IPR003340B3 DNA binding domain
SuperFamilySSF1019361.33E-13124221IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
ISEKEVEENV QKESDQSSPD LNCFSQTVTH SSISRDLVTL PRDFAKRNGL DKGMHEIVLM  60
NEEGKSWKSK VKSNMSRQVY IVGGWRNLCT ENKLEVGDSC TFKLLQNAKT PVFQLCSRTG  120
ESQFVKLTPT LNSLEIGKQH LPVSFTKVNG LINPGKMTLV DKDRVEWSMK LQVDTRGGMY  180
IFGGTDWKSF CAANEVGKRE SLTLKLIRGG LSPLLKFCSK MEPPSVEAEG RTHKRARVQN  240
GSHETDKGEP SRASMGPELE IREKTAEKGE PSRASNISRG NQGNLQKTQP CSVTDQVAKV  300
KESVLDTLTS TRRFQAELET MERKLEDSLQ EINKLGMIY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5152620.0AJ515262.1 Arabidopsis thaliana mRNA for putative auxin response factor 24 (arf24 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194896.20.0transcriptional factor B3 family protein
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLR0GZI51e-153R0GZI5_9BRAS; Uncharacterized protein
STRINGAT4G31680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein