PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.2637s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 131aa    MW: 15318 Da    PI: 7.8455
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.2637s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.73.5e-4352129178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C+ad+s+ak+yh+rhkvCe+h+kap v + gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++
  Araha.2637s0018.1.p  52 VCQVESCTADMSKAKQYHKRHKVCEFHAKAPLVRIYGLHQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSTT 129
                          6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.2E-581130IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.103.8E-3346114IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.26550127IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3852129IPR004333Transcription factor, SBP-box
PfamPF031108.1E-3353126IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MSMRRSKAEG KRSLREMSEE EEDEETEDED TFEEEEALEK KQKAKATSSS GVCQVESCTA  60
DMSKAKQYHK RHKVCEFHAK APLVRIYGLH QRFCQQCSRF HELSEFDEAK RSCRRRLAGH  120
NERRRKSTTE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3846126284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0054430.0BT005443.1 Arabidopsis thaliana clone U50647 putative squamosa-promoter binding protein (At2g33810) mRNA, complete cds.
GenBankAK1181790.0AK118179.1 Arabidopsis thaliana At2g33810 mRNA for putative squamosa-promoter binding protein, complete cds, clone: RAFL19-50-A02.
GenBankY094270.0Y09427.1 A.thaliana mRNA for squamosa-promoter binding protein like 3.
GenBankAJ2429590.0AJ242959.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 3 (SPL3 gene).
GenBankAJ0116330.0AJ011633.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002879473.12e-89hypothetical protein ARALYDRAFT_482334
SwissprotP930153e-69SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLD7LGF02e-89D7LGF0_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.4__1394__AT2G33810.16e-89(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-68squamosa promoter binding protein-like 3