PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.25334s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 289aa    MW: 33222.6 Da    PI: 5.7245
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.25334s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.4e-56201461129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeel+++yLk+kv ++ +++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkd
  Araha.25334s0001.1.p  20 LPPGFRFHPTDEELITHYLKPKVFNTFFSA-TAIGEVDLNKIEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKD 107
                           79*************************999.88***************888999*********************************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           ke+++ +++lvg+kktLvfykgrapkg+kt+Wvmheyrle
  Araha.25334s0001.1.p 108 KEIFK-GKSLVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 146
                           *****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6416170IPR003441NAC domain
PROSITE profilePS5100559.96320170IPR003441NAC domain
PfamPF023656.9E-3021145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0010029Biological Processregulation of seed germination
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048527Biological Processlateral root development
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:0090400Biological Processstress-induced premature senescence
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1902074Biological Processresponse to salt
GO:1904250Biological Processpositive regulation of age-related resistance
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDYEASRICE MVEDDEQIDL PPGFRFHPTD EELITHYLKP KVFNTFFSAT AIGEVDLNKI  60
EPWDLPWKAK MGEKEWYFFC VRDRKYPTGL RTNRATEAGY WKATGKDKEI FKGKSLVGMK  120
KTLVFYKGRA PKGVKTNWVM HEYRLEGKYS IENLPQTAKN EWVICRVFQK RADGTKVPMS  180
MLDPHTNRIE PTGLPSLMDC SQRDSITGSS SHVTCFSDQE TEDKRLVHES REGFGSLFYS  240
DPLFLQDNYS LMKLLLDGQE PQFPGRSFDG RDSSGLAGTE ELDCVWNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-541717614171NO APICAL MERISTEM PROTEIN
1ut4_B1e-541717614171NO APICAL MERISTEM PROTEIN
1ut7_A1e-541717614171NO APICAL MERISTEM PROTEIN
1ut7_B1e-541717614171NO APICAL MERISTEM PROTEIN
4dul_A1e-541717614171NAC domain-containing protein 19
4dul_B1e-541717614171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269|PubMed:15295076, ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:21303842, ECO:0000269|PubMed:23340744, ECO:0000269|PubMed:23459204, ECO:0000269|PubMed:9351240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00535DAPTransfer from AT5G39610Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.25334s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19608714, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:20404534, ECO:0000269|PubMed:21511905, ECO:0000269|PubMed:22930749}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0563270.0AY056327.1 Arabidopsis thaliana putative NAM / CUC2 protein (At5g39610) mRNA, complete cds.
GenBankAY0846350.0AY084635.1 Arabidopsis thaliana clone 113779 mRNA, complete sequence.
GenBankAY0911910.0AY091191.1 Arabidopsis thaliana putative NAM/CUC2 protein (At5g39610) mRNA, complete cds.
GenBankAY1741630.0AY174163.1 Arabidopsis thaliana ecotype Columbia no apical meristem-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020872969.10.0NAC domain-containing protein 92
SwissprotQ9FKA00.0NAC92_ARATH; NAC domain-containing protein 92
TrEMBLX2FXQ10.0X2FXQ1_ARAAE; NAC2
STRINGfgenesh2_kg.7__3461__AT5G39610.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.10.0NAC domain containing protein 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  3. Khan M,Rozhon W,Poppenberger B
    The role of hormones in the aging of plants - a mini-review.
    Gerontology, 2014. 60(1): p. 49-55
    [PMID:24135638]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N
    Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast.
    Plant J., 2015. 81(3): p. 377-87
    [PMID:25440717]
  6. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  7. Kim H, et al.
    Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453
    [PMID:30065116]