PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.23334s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 290aa    MW: 32409.7 Da    PI: 7.9749
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.23334s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18208242135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C++C ttkTp+WR+gp g+ktLCnaCG+++++ +l
  Araha.23334s0009.1.p 208 CTHCETTKTPQWREGPCGPKTLCNACGVRFKSGRL 242
                           *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.1E-18202252IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15206265No hitNo description
Gene3DG3DSA:3.30.50.101.6E-14206240IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.952206238IPR000679Zinc finger, GATA-type
CDDcd002023.03E-16207256No hitNo description
PfamPF003202.6E-16208242IPR000679Zinc finger, GATA-type
PROSITE patternPS003440208233IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MNWSPEAEAE EHFKGLLSGD FFDGLTNHLD CPLEDIDSTN VEGDWVARFQ DLEPPPMDMF  60
PALPSELTSC AILKDKGARV GFRKNMKQSC SSEALSGINS TFHQSSAPPE INVSKLFQSL  120
GPVSVLERLA FPVKGMRTKR KRPTTLRLSY LFPFEPRNPE KSTPGETEAE SYYYSEQHAK  180
KKHKIHLITH TVSSSFEACN SDGIVRKCTH CETTKTPQWR EGPCGPKTLC NACGVRFKSG  240
RLVPEYRPAS SPTFIPSVHS NSHRKIIEMR RKDDEQFDTS MIRAVISGA*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.23334s0009.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934410.0AB493441.1 Arabidopsis thaliana At1g08010 mRNA for hypothetical protein, partial cds, clone: RAAt1g08010.
GenBankAC0268750.0AC026875.4 Genomic sequence for Arabidopsis thaliana BAC T6D22 from chromosome I, complete sequence.
GenBankAK2293660.0AK229366.1 Arabidopsis thaliana mRNA for putative GATA transcription factor 3, complete cds, clone: RAFL16-61-D15.
GenBankBT0149740.0BT014974.1 Arabidopsis thaliana At1g08010 gene, complete cds.
GenBankBT0157130.0BT015713.1 Arabidopsis thaliana At1g08010 gene, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020866856.10.0GATA transcription factor 10-like
RefseqXP_020866857.10.0GATA transcription factor 10-like
RefseqXP_020866858.10.0GATA transcription factor 10-like
RefseqXP_020866859.10.0GATA transcription factor 10-like
SwissprotQ6DBP81e-169GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A384LF571e-166A0A384LF57_ARATH; GATA11
TrEMBLQ0WNS01e-166Q0WNS0_ARATH; Putative GATA transcription factor 3
STRINGAT1G08010.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-150GATA transcription factor 11