PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.21283s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 364aa    MW: 40654.4 Da    PI: 4.4912
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.21283s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM144.75.1e-4561341129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           l+pGfrFhPtd elv +yLk+kv gkk+++ ++i+e+diyk+eP dLp k ++ +++ +wyfF++r+kky++g ++nr+t+ gyWk+tg
  Araha.21283s0004.1.p   6 LAPGFRFHPTDVELVRYYLKRKVMGKKFQV-DAIAEIDIYKFEPPDLPeKsCLGTGDLKWYFFCPREKKYPKGGKANRSTECGYWKTTG 93 
                           579***************************.99**************95347777888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           +d++v   ++e++g  +tL+++ g+ p+g +tdWv+heyrle
  Araha.21283s0004.1.p  94 RDRDVSY-NDEVTGKIRTLIYHYGKIPRGDRTDWVIHEYRLE 134
                           ******9.9999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-533156IPR003441NAC domain
PROSITE profilePS5100551.1236156IPR003441NAC domain
PfamPF023652.5E-248133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGKTNLAPGF RFHPTDVELV RYYLKRKVMG KKFQVDAIAE IDIYKFEPPD LPEKSCLGTG  60
DLKWYFFCPR EKKYPKGGKA NRSTECGYWK TTGRDRDVSY NDEVTGKIRT LIYHYGKIPR  120
GDRTDWVIHE YRLEDKVLAQ KNVPQDTYVL CVLFKKNGLG PRHGSQYGAP FKEEDWSDKE  180
EEYTQNHLVA VPCAENTNPG PSKETSLAAT ASQSHAPKDC FTGVISESCV SDVPPLTATV  240
LPPLTSDVVA YNPMSSSPLP EVPQVSLDDE ELNSMLDLFS VDNDDCLVFD DFDYQNEVRH  300
EPDVFVNEEA PVFLGDGNFS GMFDLSNDLV VELQDLIQPA TPPPPPPPAQ ASNPDDSRSN  360
GQT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-44515714169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.21283s0004.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0118220.0BT011822.1 Arabidopsis thaliana At5g49950 mRNA sequence.
GenBankBT0155830.0BT015583.1 Arabidopsis thaliana At5g64060 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020871996.10.0NAC domain-containing protein 82
SwissprotQ9FY821e-129NAC82_ARATH; NAC domain-containing protein 82
TrEMBLD7MQK60.0D7MQK6_ARALL; ANAC103
STRINGfgenesh2_kg.8__2417__AT5G64060.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.10.0NAC domain containing protein 103
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]