PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.20405s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 210aa    MW: 24311.4 Da    PI: 8.8416
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.20405s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.8e-5491381129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeel+++yLkkk++ +k+e+ evi+evd++k+ePwdL++++k     ++ewyfFs++d+ky+tg+r+nrat++g+Wkat
  Araha.20405s0001.1.p   9 VPPGFRFHPTDEELLHYYLKKKISYQKFEM-EVIREVDLNKLEPWDLQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRATHAGFWKAT 96 
                           69****************************.99**************964444222455****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           g+dk + + + +++g++ktLvfykgrap+g+ktdW+mheyrle
  Araha.20405s0001.1.p  97 GRDKCIRN-SYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 138
                           *******9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-568147IPR003441NAC domain
PROSITE profilePS5100553.8779168IPR003441NAC domain
PfamPF023651.6E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGSSSNGGVP PGFRFHPTDE ELLHYYLKKK ISYQKFEMEV IREVDLNKLE PWDLQERCKI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATHA GFWKATGRDK CIRNSYKKIG MRKTLVFYKG  120
RAPHGQKTDW IMHEYRLEDA DDPQANPSVC LGEWAMMDRL VTCHMANEDS SRGIRFEDGN  180
NNSSSVVQPV PATNQLTLRS EMDFWGYSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-49913715140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.20405s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1336810.0AY133681.1 Arabidopsis thaliana clone C103095 putative NAM/NAP (At4g10350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192773.11e-108NAC domain containing protein 70
RefseqXP_013691786.11e-110protein BEARSKIN2-like
SwissprotQ9SV871e-109BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A178UTT11e-107A0A178UTT1_ARATH; NAC070
STRINGAT4G10350.11e-107(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-112NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]