PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.19457s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 325aa    MW: 36382.7 Da    PI: 8.4543
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.19457s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.3e-53161421128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+d
  Araha.19457s0003.1.p  16 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-SIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTD 103
                           79****************************.89***************9888999********************************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           k++++ ++++vg+kk Lvfy g+ pkg ktdW+mheyrl
  Araha.19457s0003.1.p 104 KPIFTCNSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRL 142
                           *************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-649178IPR003441NAC domain
PROSITE profilePS5100560.52116177IPR003441NAC domain
PfamPF023651.4E-2717142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MENMGDSTIG PGHPHLPPGF RFHPTDEELV VHYLKKKAAS VPLPVSIIAE IDLYKFDPWE  60
LPSKASFGEH EWYFFSPRDR KYPNGVRPNR AATSGYWKAT GTDKPIFTCN SHKVGVKKAL  120
VFYGGKPPKG IKTDWIMHEY RLTDGNLSTS AKPPDLATTR KNSLRLDDWV LCRIYKKNSS  180
QRPTMERVLL REDLMEGMLS KSSANSSSTS VLDNNDNNNN NNNEEHFFDG MVVSSDKRSL  240
CGQYRMGHEA SGSSSFGSFL SSKRFHHTGD LNNDNYNVSF VSMLSEIPQS SGFHANGVMD  300
TTSSLADHGV LRQAFQLPNM NWHS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-741618017168NO APICAL MERISTEM PROTEIN
1ut4_B6e-741618017168NO APICAL MERISTEM PROTEIN
1ut7_A6e-741618017168NO APICAL MERISTEM PROTEIN
1ut7_B6e-741618017168NO APICAL MERISTEM PROTEIN
3swm_A5e-741618020171NAC domain-containing protein 19
3swm_B5e-741618020171NAC domain-containing protein 19
3swm_C5e-741618020171NAC domain-containing protein 19
3swm_D5e-741618020171NAC domain-containing protein 19
3swp_A5e-741618020171NAC domain-containing protein 19
3swp_B5e-741618020171NAC domain-containing protein 19
3swp_C5e-741618020171NAC domain-containing protein 19
3swp_D5e-741618020171NAC domain-containing protein 19
4dul_A6e-741618017168NAC domain-containing protein 19
4dul_B6e-741618017168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.19457s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1178780.0AK117878.1 Arabidopsis thaliana At1g61110 mRNA for unknown protein, complete cds, clone: RAFL19-05-K20.
GenBankBT0083460.0BT008346.1 Arabidopsis thaliana At1g61110 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010430102.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY420.0NAC25_ARATH; NAC transcription factor 25
TrEMBLD7KW470.0D7KW47_ARALL; ANAC025
STRINGXP_010430102.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.10.0NAC domain containing protein 25