PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.19157s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 513aa    MW: 57596.2 Da    PI: 5.1366
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.19157s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.4e-5491351127
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lp GfrF+Ptdeelv++yL+ k++g++ ++ +vi+++d++k+ePwdLp+   +k+++ ew+fF++rd+ky++g+r+nrat+sgyWkatg
  Araha.19157s0013.1.p   9 LPLGFRFRPTDEELVNHYLRLKINGRHSDV-RVIPDIDVCKWEPWDLPAlsVIKTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATG 96 
                           699************************999.99***************4447888889******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                           kd++++s k++l+g+kktLvfy+grapkge+t+W+mheyr
  Araha.19157s0013.1.p  97 KDRSIKS-KKTLIGMKKTLVFYRGRAPKGERTNWIMHEYR 135
                           *******.999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-635159IPR003441NAC domain
PROSITE profilePS5100558.0369159IPR003441NAC domain
PfamPF023651.1E-2810135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0071470Biological Processcellular response to osmotic stress
GO:1900426Biological Processpositive regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MGAVSMDSLP LGFRFRPTDE ELVNHYLRLK INGRHSDVRV IPDIDVCKWE PWDLPALSVI  60
KTDDPEWFFF CPRDRKYPNG HRSNRATDSG YWKATGKDRS IKSKKTLIGM KKTLVFYRGR  120
APKGERTNWI MHEYRPTLKD LDGTSPGQSP YVLCRLFHKL DDRVNGVKSD EAAPTTCNKY  180
SPDDTSSDLV QETPSSDAAV EKPSDYSGGC GYAQSNTADG AMIEAPEENL WLPCDLEDRR  240
APLPRMDYTY AGDFSYDEIG FQFQDGTSEP DVSLTELLEE VFNNPDDFSC EESVSRENTV  300
APNGIFSSSK ILQSPAPEDV FFNDFMAYTN TDAEMGQLQY DSNGGASGWP RDYSDLVHPE  360
QMLNHNTENN VTEGRGIKIR ARQPQNRQST GLINQGIAPR RIRLQLQSSS KPPDEKNQSE  420
VNQQEEVNEG HTVIPETKEV AAEKSDALVK PQIKLRARGT IGQVKAERIA DNEVQVQSKK  480
RREGNRWKVV ATVMVTVMVV VGVGIWRTLV SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-45815916165NO APICAL MERISTEM PROTEIN
1ut4_B2e-45815916165NO APICAL MERISTEM PROTEIN
1ut7_A2e-45815916165NO APICAL MERISTEM PROTEIN
1ut7_B2e-45815916165NO APICAL MERISTEM PROTEIN
3swm_A2e-45815919168NAC domain-containing protein 19
3swm_B2e-45815919168NAC domain-containing protein 19
3swm_C2e-45815919168NAC domain-containing protein 19
3swm_D2e-45815919168NAC domain-containing protein 19
3swp_A2e-45815919168NAC domain-containing protein 19
3swp_B2e-45815919168NAC domain-containing protein 19
3swp_C2e-45815919168NAC domain-containing protein 19
3swp_D2e-45815919168NAC domain-containing protein 19
4dul_A2e-45815916165NAC domain-containing protein 19
4dul_B2e-45815916165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00108PBMTransfer from AT4G35580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.19157s0013.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0311350.0AL031135.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F8D20 (ESSAII project).
GenBankAL1615870.0AL161587.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 83.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020872812.10.0protein NTM1-like 9 isoform X1
SwissprotF4JN350.0NTL9_ARATH; Protein NTM1-like 9
TrEMBLD7MCZ00.0D7MCZ0_ARALL; Predicted protein
STRINGfgenesh2_kg.7__521__AT4G35580.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.10.0NAC transcription factor-like 9
Publications ? help Back to Top
  1. Zheng XY, et al.
    Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73
    [PMID:26139525]
  2. Guo T, et al.
    Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana.
    Mol Plant, 2017. 10(10): p. 1334-1348
    [PMID:28943325]