PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.18871s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 409aa    MW: 46175.1 Da    PI: 6.3765
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.18871s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.92.4e-42129204277
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           Cqv gC++dls+ k+yh+rh+vCe+hsk++vv+v+gleqrfCqqCsrfh lsefD++krsCrrrLa+hnerrrk++
  Araha.18871s0007.1.p 129 CQVYGCNMDLSSSKDYHKRHRVCEAHSKTSVVVVKGLEQRFCQQCSRFHFLSEFDDGKRSCRRRLAGHNERRRKPA 204
                           **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33124190IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.821126203IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-40127206IPR004333Transcription factor, SBP-box
PfamPF031102.0E-32129202IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MDDSWSYGRS VFMSNETLLP FDSFAENRRF EQRLSNELEN DDDDVLISDM AGNSNGFSAV  60
SITKVVPEEE EEENQSSSSK LSSQELNRMD FKLRSFLDLG NDDDTSSRGF ALPAKTSRAS  120
NLCSQNPLCQ VYGCNMDLSS SKDYHKRHRV CEAHSKTSVV VVKGLEQRFC QQCSRFHFLS  180
EFDDGKRSCR RRLAGHNERR RKPAFYFLPG KRHKLLRTSQ GVVGNKFLEN SSLLLPESFP  240
GSLLYRVIDD DDHRASRLVS FKDEPTCSMF PAIGQNSSTT YESKPAIYSA EVSSIWDLHE  300
AASRSTCALS LLSAQSQQHL SQIPNTTFSI TQPNQNPNHP SPVDYHQMEP FWIDPGKTNP  360
IGSSSRTVKG PSTVDLLQLS SHLQRIEQQR NYTSDVKQEY NELYFPGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-301282021084squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description